StarFunc result for job id P61647

User Input

>input (398 residues)
MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATA
VPRATNSTYLNEKSLQLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAE
EYANFRAKLASCCDAVQNFVVSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVD
YPYNQCAVVGNGGILNKSLCGTEIDKSDFVFRCNLPPTTGDVSKDVGSKTNLVTINPSII
TLKYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTSFKVYYTLEESKARQKVLFFH
PKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTVEDIPVSHHYY
DNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61647	1.000	1.000	3.878E-77	398	1.000	1.000	P61647.pdb.gz	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
2	AFDB:Q8K4T1	0.900	0.900	1.585E-68	398	0.827	0.827	Q8K4T1.pdb.gz	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
3	AFDB:G3V7T2	0.742	0.829	1.267E-39	356	0.332	0.371	G3V7T2.pdb.gz	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
4	AFDB:Q6ZXC8	0.768	0.811	3.450E-38	376	0.347	0.367	Q6ZXC8.pdb.gz	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
5	AFDB:F1R0F8	0.710	0.786	4.588E-38	359	0.344	0.382	F1R0F8.pdb.gz
6	AFDB:P70126	0.767	0.742	5.141E-38	412	0.377	0.364	P70126.pdb.gz	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2
7	AFDB:Q6ZXA0	0.745	0.825	6.100E-38	359	0.329	0.365	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
8	AFDB:O15466	0.767	0.810	8.111E-38	376	0.327	0.346	O15466.pdb.gz	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
9	AFDB:Q6KC03	0.696	0.769	1.985E-29	358	0.244	0.271	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
10	AFDB:A1KQY6	0.676	0.596	5.229E-29	454	0.249	0.218	A1KQY6.pdb.gz	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
11	PDB:6aplC	0.473	0.599	1.006E-9	306	0.156	0.203	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:3geiA	0.144	0.137	2.826E-2	428	0.063	0.058	3geiA.pdb.gz
13	PDB:2b5wA	0.133	0.144	5.599E-2	357	0.043	0.048	2b5wA.pdb.gz	Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei.
14	PDB:7awtG	0.161	0.087	8.832E-2	907	0.085	0.037	7awtG.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
15	PDB:6dkhC	0.132	0.144	9.898E-2	346	0.060	0.069	6dkhC.pdb.gz	The crystal structure of L-idonate 5-dehydrogenase from Escherichia coli str. K-12 substr. MG1655
16	PDB:4a2cA	0.143	0.159	1.048E-1	346	0.055	0.064	4a2cA.pdb.gz	The Crystal Structure of Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli K12 Provides Insights Into its Anomalous Behavior on Imac Processes
17	PDB:4djdD	0.197	0.226	1.316E-1	323	0.063	0.077	4djdD.pdb.gz	Visualizing molecular juggling within a B12-dependent methyltransferase complex.
18	PDB:4z3dA	0.124	0.146	1.852E-1	276	0.073	0.105	4z3dA.pdb.gz	Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
19	PDB:5ocwA	0.185	0.258	1.852E-1	257	0.075	0.117	5ocwA.pdb.gz	Inhibiting mycobacterial tryptophan synthase by targeting the inter-subunit interface.
20	PDB:1ldbA	0.119	0.142	1.961E-1	294	0.043	0.058	1ldbA.pdb.gz	Structure determination and refinement of Bacillus stearothermophilus lactate dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61647	0.0	829	398	1.000	1.000	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
2	Q8K4T1	0.0	688	398	0.827	0.827	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
3	Q92185	5.02e-92	282	356	0.319	0.357	SIA8A_HUMAN Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA1 PE=1 SV=1
4	G3V7T2	7.45e-90	277	356	0.312	0.348	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
5	Q6ZXC8	7.87e-90	278	376	0.329	0.348	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
6	Q64687	3.21e-89	275	355	0.309	0.346	SIA8A_MOUSE Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia1 PE=1 SV=2
7	P70126	1.32e-88	276	412	0.327	0.316	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2
8	O15466	3.33e-86	268	376	0.312	0.330	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
9	Q6ZXA0	9.51e-86	266	359	0.307	0.340	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
10	B0CN48	8.01e-56	189	374	0.276	0.294	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
11	O43173	1.53e-54	186	380	0.271	0.284	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
12	Q64689	2.85e-53	183	380	0.269	0.282	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
13	Q6KC03	1.09e-47	168	358	0.229	0.254	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
14	Q64690	1.25e-43	157	359	0.216	0.240	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1
15	Q64692	1.39e-43	157	359	0.219	0.242	SIA8D_MOUSE CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia4 PE=2 SV=1
16	Q92187	3.37e-43	156	359	0.216	0.240	SIA8D_HUMAN CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA4 PE=1 SV=1
17	Q92186	1.71e-42	154	375	0.221	0.235	SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B OS=Homo sapiens OX=9606 GN=ST8SIA2 PE=2 SV=1
18	A1KQY6	1.84e-42	156	454	0.211	0.185	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
19	O35696	1.55e-41	152	375	0.219	0.232	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
20	Q07977	1.60e-41	152	375	0.224	0.237	SIA8B_RAT Alpha-2,8-sialyltransferase 8B OS=Rattus norvegicus OX=10116 GN=St8sia2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	1.9e-68	242.6	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393887	0.764	Alpha-2-HS-glycoprotein
2	9606.ENSP00000367319	0.647	F-box only protein 47
3	9606.ENSP00000476792	0.518	Retrotransposon Gag-like protein 5
4	9606.ENSP00000362235	0.517	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
5	9606.ENSP00000480884	0.504	Type 2 lactosamine alpha-2,3-sialyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0003828	0.504	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity
GO:0005488	0.442	binding
GO:0005515	0.392	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0009987	0.987	cellular process
GO:0044237	0.980	cellular metabolic process
GO:0005975	0.972	carbohydrate metabolic process
GO:0006643	0.911	membrane lipid metabolic process
GO:0006807	0.905	nitrogen compound metabolic process
GO:1901564	0.903	organonitrogen compound metabolic process
GO:0006664	0.899	glycolipid metabolic process
GO:0006665	0.880	sphingolipid metabolic process
GO:1901576	0.875	organic substance biosynthetic process
GO:0043170	0.854	macromolecule metabolic process
GO:1901566	0.849	organonitrogen compound biosynthetic process
GO:0044249	0.844	cellular biosynthetic process
GO:1901137	0.841	carbohydrate derivative biosynthetic process
GO:0019538	0.815	protein metabolic process
GO:0044260	0.794	cellular macromolecule metabolic process
GO:0009247	0.779	glycolipid biosynthetic process
GO:0009100	0.767	glycoprotein metabolic process
GO:0006687	0.637	glycosphingolipid metabolic process
GO:0009059	0.635	macromolecule biosynthetic process
GO:0043412	0.550	macromolecule modification
GO:0030148	0.538	sphingolipid biosynthetic process
GO:0070085	0.497	glycosylation
GO:0009101	0.494	glycoprotein biosynthetic process
GO:0036211	0.434	protein modification process
GO:0043413	0.380	macromolecule glycosylation
GO:0006486	0.354	protein glycosylation
GO:0006688	0.347	glycosphingolipid biosynthetic process
GO:0032502	0.327	developmental process
GO:0032501	0.307	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:19313	0.504	an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+)
EC:2.4.99.8	0.504	Transferred entry: 2.4.3.8.

[back to server]