StarFunc result for job id P61758

User Input

>input (197 residues)
MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKY
KFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPT
DKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVY
NWDVKRRNKDDSTKNKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61758	1.000	1.000	1.821E-32	197	1.000	1.000	P61758.pdb.gz	PFD3_HUMAN Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 PE=1 SV=4
2	AFDB:Q9VGP6	0.873	0.886	5.777E-19	194	0.472	0.479	Q9VGP6.pdb.gz	PFD3_DROME Prefoldin subunit 3 OS=Drosophila melanogaster OX=7227 GN=mgr PE=1 SV=3
3	AFDB:P57741	0.852	0.861	8.100E-17	195	0.391	0.395	P57741.pdb.gz	PFD3_ARATH Prefoldin subunit 3 OS=Arabidopsis thaliana OX=3702 GN=PFD3 PE=1 SV=1
4	AFDB:O18054	0.819	0.869	1.205E-14	185	0.350	0.373	O18054.pdb.gz	PFD3_CAEEL Probable prefoldin subunit 3 OS=Caenorhabditis elegans OX=6239 GN=pfd-3 PE=3 SV=1
5	AFDB:Q10143	0.754	0.872	1.029E-13	169	0.365	0.426	Q10143.pdb.gz	PFD3_SCHPO Probable prefoldin subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H8.07c PE=3 SV=1
6	AFDB:P48363	0.815	0.808	1.385E-13	199	0.371	0.367	P48363.pdb.gz	PFD3_YEAST Prefoldin subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAC10 PE=1 SV=1
7	AFDB:Q8T965	0.749	0.806	2.722E-12	182	0.234	0.253	Q8T965.pdb.gz	Q8T965_DROME Prefoldin subunit 3 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15676 PE=1 SV=1
8	PDB:2zdiC	0.573	0.733	1.490E-6	148	0.142	0.189	2zdiC.pdb.gz
9	AFDB:Q9VJP9	0.584	0.693	2.568E-6	162	0.127	0.154	Q9VJP9.pdb.gz	Q9VJP9_DROME GEO12025p1 OS=Drosophila melanogaster OX=7227 GN=Uxt PE=1 SV=3
10	AFDB:O58263	0.596	0.766	2.893E-6	148	0.157	0.209	O58263.pdb.gz	PFDA_PYRHO Prefoldin subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdA PE=1 SV=2
11	AFDB:Q9UBK9	0.579	0.710	1.282E-5	157	0.117	0.146	Q9UBK9.pdb.gz	UXT_HUMAN Protein UXT OS=Homo sapiens OX=9606 GN=UXT PE=1 SV=1
12	PDB:2zdiB	0.450	0.806	2.049E-2	106	0.076	0.142	2zdiB.pdb.gz
13	PDB:5d80G	0.310	0.276	1.378E-1	223	0.117	0.103	5d80G.pdb.gz
14	PDB:6vq6H	0.234	0.217	2.219E-1	214	0.112	0.103	6vq6H.pdb.gz	Structure of V-ATPase from the mammalian brain.
15	PDB:8cxm0	0.428	0.325	5.108E-1	267	0.091	0.067	8cxm0.pdb.gz
16	PDB:7nsuD	0.289	0.165	6.107E-1	420	0.081	0.038	7nsuD.pdb.gz
17	PDB:5ew5A	0.283	0.147	6.482E-1	490	0.076	0.031	5ew5A.pdb.gz
18	PDB:7khwA	0.313	0.340	6.482E-1	174	0.107	0.121	7khwA.pdb.gz
19	PDB:5ynxA	0.159	0.256	7.750E-1	117	0.102	0.171	5ynxA.pdb.gz
20	PDB:7aqcR	0.274	0.133	7.750E-1	558	0.081	0.029	7aqcR.pdb.gz	Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61758	1.34e-146	407	197	1.000	1.000	PFD3_HUMAN Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 PE=1 SV=4
2	P61759	1.04e-139	389	196	0.970	0.974	PFD3_MOUSE Prefoldin subunit 3 OS=Mus musculus OX=10090 GN=Vbp1 PE=1 SV=2
3	Q2TBX2	2.36e-138	386	197	0.949	0.949	PFD3_BOVIN Prefoldin subunit 3 OS=Bos taurus OX=9913 GN=VBP1 PE=2 SV=1
4	Q9VGP6	5.92e-66	202	194	0.492	0.500	PFD3_DROME Prefoldin subunit 3 OS=Drosophila melanogaster OX=7227 GN=mgr PE=1 SV=3
5	P57741	2.55e-46	152	195	0.365	0.369	PFD3_ARATH Prefoldin subunit 3 OS=Arabidopsis thaliana OX=3702 GN=PFD3 PE=1 SV=1
6	O18054	1.67e-41	140	185	0.360	0.384	PFD3_CAEEL Probable prefoldin subunit 3 OS=Caenorhabditis elegans OX=6239 GN=pfd-3 PE=3 SV=1
7	Q10143	4.05e-37	128	169	0.381	0.444	PFD3_SCHPO Probable prefoldin subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H8.07c PE=3 SV=1
8	P48363	5.42e-36	126	199	0.376	0.372	PFD3_YEAST Prefoldin subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAC10 PE=1 SV=1
9	Q8T965	6.22e-17	77.0	182	0.269	0.291	Q8T965_DROME Prefoldin subunit 3 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15676 PE=1 SV=1
10	Q66IA7	0.11	34.3	155	0.112	0.142	Q66IA7_DANRE Protein UXT OS=Danio rerio OX=7955 GN=zgc:101894 PE=1 SV=1
11	Q966M4	0.18	34.7	446	0.127	0.056	Q966M4_CAEEL Unconventional prefoldin RPB5 interactor OS=Caenorhabditis elegans OX=6239 GN=uri-1 PE=1 SV=1
12	O58263	2.6	30.4	148	0.142	0.189	PFDA_PYRHO Prefoldin subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdA PE=1 SV=2
13	Q9Z1S5	4.6	30.4	350	0.091	0.051	SEPT3_MOUSE Neuronal-specific septin-3 OS=Mus musculus OX=10090 GN=Septin3 PE=1 SV=2
14	Q9WU34	4.7	30.4	358	0.091	0.050	SEPT3_RAT Neuronal-specific septin-3 OS=Rattus norvegicus OX=10116 GN=Septin3 PE=1 SV=2
15	Q9UH03	4.8	30.0	358	0.091	0.050	SEPT3_HUMAN Neuronal-specific septin-3 OS=Homo sapiens OX=9606 GN=SEPTIN3 PE=1 SV=3
16	Q55FX5	6.3	30.0	1382	0.086	0.012	Q55FX5_DICDI Phosphatidylinositol 3-kinase OS=Dictyostelium discoideum OX=44689 GN=pikF PE=3 SV=1
17	Q4U0S5	7.9	29.6	503	0.086	0.034	PAF1_DANRE RNA polymerase II-associated factor 1 homolog OS=Danio rerio OX=7955 GN=paf1 PE=1 SV=1
18	P28223	9.2	29.3	471	0.081	0.034	5HT2A_HUMAN 5-hydroxytryptamine receptor 2A OS=Homo sapiens OX=9606 GN=HTR2A PE=1 SV=2
19	P9WH75	9.9	29.3	725	0.102	0.028	RIR1_MYCTU Ribonucleoside-diphosphate reductase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nrdE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02996 Prefoldin	1.9e-35	132.7	Prefoldin subunit
2	PF01920 Prefoldin_2	0.1	24.0	Prefoldin subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017635

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021490	0.999	Prefoldin subunit 5
2	61853.ENSNLEP00000008329	0.998	Prefoldin subunit 6
3	61853.ENSNLEP00000016988	0.998	Prefoldin subunit 2
4	61853.ENSNLEP00000008561	0.997	Prefoldin subunit 4
5	61853.ENSNLEP00000011224	0.997	Prefoldin subunit 1
6	61853.ENSNLEP00000005749	0.905	Bardet-Biedl syndrome 10
7	61853.ENSNLEP00000004035	0.846	Chaperonin containing TCP1 subunit 8
8	61853.ENSNLEP00000011878	0.845	T-complex protein 1 subunit delta
9	61853.ENSNLEP00000013680	0.839	T-complex 1
10	61853.ENSNLEP00000004793	0.816	Chaperonin containing TCP1 subunit 2
11	61853.ENSNLEP00000004197	0.814	Ubiquitously-expressed, prefoldin-like chaperone
12	61853.ENSNLEP00000015267	0.813	T-complex protein 1 subunit gamma
13	61853.ENSNLEP00000001913	0.809	Transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
14	61853.ENSNLEP00000000340	0.790	Coiled-coil domain containing 58
15	61853.ENSNLEP00000012817	0.763	Chaperonin containing TCP1 subunit 7
16	61853.ENSNLEP00000019098	0.756	Chaperonin containing TCP1 subunit 6A
17	61853.ENSNLEP00000011710	0.743	mutS homolog 4
18	61853.ENSNLEP00000014095	0.729	Uncharacterized protein
19	61853.ENSNLEP00000019927	0.729	Uncharacterized protein
20	61853.ENSNLEP00000023074	0.727	Programmed cell death 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051082	0.999	unfolded protein binding
GO:0001540	0.997	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0006457	0.976	protein folding
GO:0080090	0.972	regulation of primary metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0048523	0.971	negative regulation of cellular process
GO:0051246	0.935	regulation of protein metabolic process
GO:1902903	0.932	regulation of supramolecular fiber organization
GO:1902904	0.843	negative regulation of supramolecular fiber organization
GO:0010605	0.802	negative regulation of macromolecule metabolic process
GO:0051172	0.790	negative regulation of nitrogen compound metabolic process
GO:0051248	0.740	negative regulation of protein metabolic process
GO:0071840	0.326	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0032991	0.992	protein-containing complex
GO:0005634	0.985	nucleus
GO:0031981	0.580	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]