StarFunc result for job id P61769

User Input

>input (119 residues)
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61769	1.000	1.000	3.041E-21	119	1.000	1.000	P61769.pdb.gz	B2MG_HUMAN Beta-2-microglobulin OS=Homo sapiens OX=9606 GN=B2M PE=1 SV=1
2	AFDB:P01887	0.923	0.923	2.065E-17	119	0.681	0.681	P01887.pdb.gz	B2MG_MOUSE Beta-2-microglobulin OS=Mus musculus OX=10090 GN=B2m PE=1 SV=2
3	AFDB:P07151	0.894	0.894	2.298E-17	119	0.697	0.697	P07151.pdb.gz	B2MG_RAT Beta-2-microglobulin OS=Rattus norvegicus OX=10116 GN=B2m PE=1 SV=1
4	PDB:6d7gA	0.819	0.253	6.870E-17	386	0.824	0.254	6d7gA.pdb.gz
5	PDB:3ov6A	0.809	0.262	8.508E-17	376	0.832	0.263	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
6	PDB:1kjvB	0.832	0.989	1.050E-15	100	0.622	0.740	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
7	PDB:3s6cA	0.816	0.264	1.995E-15	372	0.832	0.266	3s6cA.pdb.gz
8	PDB:3nwmA	0.834	0.261	1.694E-14	384	0.580	0.180	3nwmA.pdb.gz
9	PDB:2qriA	0.834	0.254	2.463E-14	398	0.588	0.176	2qriA.pdb.gz
10	PDB:6e1iA	0.814	0.251	3.051E-14	389	0.605	0.185	6e1iA.pdb.gz
11	PDB:6mp0A	0.821	0.254	4.205E-14	388	0.580	0.178	6mp0A.pdb.gz
12	AFDB:C1BFC6	0.839	0.858	1.560E-13	116	0.412	0.422	C1BFC6.pdb.gz	C1BFC6_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2MG PE=2 SV=1
13	AFDB:C1BHK1	0.862	0.883	3.126E-13	116	0.429	0.440	C1BHK1.pdb.gz	C1BHK1_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2MG PE=2 SV=1
14	AFDB:F5H6I0	0.571	0.670	4.546E-13	101	0.756	0.891	F5H6I0.pdb.gz	F5H6I0_HUMAN Beta-2-microglobulin OS=Homo sapiens OX=9606 GN=B2M PE=1 SV=2
15	AFDB:P06340	0.815	0.399	3.096E-10	250	0.269	0.128	P06340.pdb.gz	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
16	AFDB:P20037	0.822	0.395	4.045E-10	256	0.269	0.125	P20037.pdb.gz	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
17	AFDB:P20036	0.798	0.380	4.749E-10	260	0.311	0.142	P20036.pdb.gz	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
18	AFDB:P01909	0.820	0.397	5.285E-10	254	0.252	0.118	P01909.pdb.gz	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
19	PDB:6cplA	0.784	0.531	2.697E-9	180	0.277	0.183	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
20	PDB:5j6hA	0.712	0.333	5.091E-7	275	0.261	0.113	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61769	4.78e-87	250	119	1.000	1.000	B2MG_HUMAN Beta-2-microglobulin OS=Homo sapiens OX=9606 GN=B2M PE=1 SV=1
2	F5H6I0	4.27e-67	199	101	0.849	1.000	F5H6I0_HUMAN Beta-2-microglobulin OS=Homo sapiens OX=9606 GN=B2M PE=1 SV=2
3	P01887	3.18e-61	184	119	0.681	0.681	B2MG_MOUSE Beta-2-microglobulin OS=Mus musculus OX=10090 GN=B2m PE=1 SV=2
4	P07151	1.53e-56	173	119	0.697	0.697	B2MG_RAT Beta-2-microglobulin OS=Rattus norvegicus OX=10116 GN=B2m PE=1 SV=1
5	Q91202	6.57e-31	108	116	0.437	0.448	Q91202_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2m PE=2 SV=1
6	Q91966	8.27e-31	107	116	0.445	0.457	Q91966_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2m PE=2 SV=1
7	Q92004	1.44e-30	107	116	0.445	0.457	Q92004_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2m PE=2 SV=1
8	Q91204	3.03e-30	106	116	0.429	0.440	Q91204_ONCMY Beta-2 microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2m PE=2 SV=1
9	C1BFC6	3.53e-30	106	116	0.429	0.440	C1BFC6_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2MG PE=2 SV=1
10	Q91203	4.59e-30	105	116	0.445	0.457	Q91203_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2m PE=2 SV=1
11	C1BHK1	8.84e-30	105	116	0.437	0.448	C1BHK1_ONCMY Beta-2-microglobulin OS=Oncorhynchus mykiss OX=8022 GN=B2MG PE=2 SV=1
12	P20036	1.96e-14	68.9	260	0.294	0.135	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
13	X5CKE2	1.96e-14	68.9	260	0.294	0.135	X5CKE2_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=3 SV=1
14	Q95HB9	2.13e-14	68.9	260	0.294	0.135	Q95HB9_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
15	J3KQ99	3.35e-14	67.8	209	0.294	0.167	J3KQ99_HUMAN Major histocompatibility complex, class II, DP alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
16	P04440	2.66e-13	65.9	258	0.294	0.136	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
17	Q95HA4	1.62e-12	63.9	257	0.261	0.121	Q95HA4_HUMAN HLA-DPB1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
18	A0A1C3PI11	1.66e-12	63.9	258	0.261	0.120	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
19	P20037	1.77e-12	63.5	256	0.252	0.117	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
20	A0A0G4PYZ0	5.10e-12	62.4	266	0.277	0.124	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	4.8e-19	79.8	Immunoglobulin C1-set domain
2	PF07679 I-set	10	17.6	Immunoglobulin I-set domain
3	PF13895 Ig_2	83	14.9	Immunoglobulin domain
4	PF13927 Ig_3	0.21	23.5	Immunoglobulin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452780

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221466	0.999	IgG receptor FcRn large subunit p51
2	9606.ENSP00000320866	0.999	Calreticulin
3	9606.ENSP00000353224	0.999	Transferrin receptor protein 1
4	9606.ENSP00000357153	0.999	Antigen-presenting glycoprotein CD1d
5	9606.ENSP00000365402	0.999	HLA class I histocompatibility antigen, Cw-7 alpha chain
6	9606.ENSP00000365817	0.999	HLA class I histocompatibility antigen, alpha chain E
7	9606.ENSP00000379873	0.999	HLA class I histocompatibility antigen, A-3 alpha chain
8	9606.ENSP00000386559	0.999	T-cell surface glycoprotein CD8 alpha chain
9	9606.ENSP00000399168	0.999	HLA class I histocompatibility antigen, B-7 alpha chain
10	9606.ENSP00000412927	0.999	HLA class I histocompatibility antigen, alpha chain G
11	9606.ENSP00000417404	0.999	Hereditary hemochromatosis protein
12	9606.ENSP00000315997	0.998	Leukocyte immunoglobulin-like receptor subfamily B member 1
13	9606.ENSP00000357150	0.998	T-cell surface glycoprotein CD1b
14	9606.ENSP00000404833	0.998	Tapasin
15	9606.ENSP00000375629	0.997	Leukocyte immunoglobulin-like receptor subfamily B member 2
16	9606.ENSP00000438038	0.997	NKG2-A/NKG2-B type II integral membrane protein
17	9606.ENSP00000300289	0.996	Protein disulfide-isomerase A3
18	9606.ENSP00000371333	0.996	Natural killer cells antigen CD94
19	9606.ENSP00000357152	0.995	T-cell surface glycoprotein CD1c
20	9606.ENSP00000289429	0.994	T-cell surface glycoprotein CD1a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	0.998	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0050789	0.947	regulation of biological process
GO:0002376	0.946	immune system process
GO:0009987	0.916	cellular process
GO:0050794	0.891	regulation of cellular process
GO:0019882	0.800	antigen processing and presentation
GO:0048518	0.757	positive regulation of biological process
GO:0006955	0.673	immune response
GO:0006950	0.655	response to stress
GO:0051716	0.564	cellular response to stimulus
GO:0006952	0.540	defense response
GO:0042221	0.508	response to chemical
GO:0032501	0.506	multicellular organismal process
GO:0009605	0.505	response to external stimulus
GO:0009607	0.486	response to biotic stimulus
GO:0051707	0.475	response to other organism
GO:0019222	0.471	regulation of metabolic process
GO:0048522	0.467	positive regulation of cellular process
GO:0051239	0.397	regulation of multicellular organismal process
GO:0060255	0.378	regulation of macromolecule metabolic process
GO:0009893	0.327	positive regulation of metabolic process
GO:0002682	0.303	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005615	0.998	extracellular space
GO:0005737	0.997	cytoplasm
GO:0071944	0.996	cell periphery
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005886	0.994	plasma membrane
GO:0031982	0.992	vesicle
GO:0012505	0.984	endomembrane system
GO:0005829	0.984	cytosol
GO:0070013	0.978	intracellular organelle lumen
GO:0032991	0.976	protein-containing complex
GO:0070062	0.958	extracellular exosome
GO:0031090	0.939	organelle membrane
GO:0005783	0.922	endoplasmic reticulum
GO:0098588	0.921	bounding membrane of organelle
GO:0030659	0.920	cytoplasmic vesicle membrane
GO:0030141	0.842	secretory granule
GO:0005768	0.794	endosome
GO:0030139	0.788	endocytic vesicle
GO:0030666	0.763	endocytic vesicle membrane
GO:0030135	0.736	coated vesicle
GO:0030662	0.712	coated vesicle membrane
GO:0005634	0.652	nucleus
GO:0031983	0.642	vesicle lumen
GO:0098796	0.528	membrane protein complex
GO:0098797	0.509	plasma membrane protein complex
GO:0030133	0.492	transport vesicle
GO:0010008	0.487	endosome membrane
GO:0034774	0.484	secretory granule lumen
GO:0030670	0.468	phagocytic vesicle membrane
GO:0098827	0.467	endoplasmic reticulum subcompartment
GO:1904724	0.436	tertiary granule lumen
GO:0042175	0.433	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005769	0.413	early endosome
GO:0005789	0.412	endoplasmic reticulum membrane
GO:0035579	0.385	specific granule membrane
GO:0031091	0.384	platelet alpha granule
GO:0030658	0.383	transport vesicle membrane
GO:0005794	0.382	Golgi apparatus
GO:0034358	0.379	plasma lipoprotein particle
GO:0031981	0.379	nuclear lumen
GO:0030134	0.350	COPII-coated ER to Golgi transport vesicle
GO:0043235	0.346	receptor complex
GO:0030054	0.320	cell junction
GO:0005654	0.304	nucleoplasm
GO:0070161	0.302	anchoring junction
GO:0055038	0.301	recycling endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]