StarFunc result for job id P61812

User Input

>input (414 residues)
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09858	0.488	0.465	3.266E-69	435	0.990	0.943	P09858.pdb.gz	TGFB2_PIG Transforming growth factor beta-2 proprotein OS=Sus scrofa OX=9823 GN=TGFB2 PE=1 SV=2
2	AFDB:Q07257	0.498	0.469	1.299E-66	442	0.952	0.891	Q07257.pdb.gz	TGFB2_RAT Transforming growth factor beta-2 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb2 PE=2 SV=2
3	AFDB:F8W4A6	0.479	0.480	2.941E-60	413	0.795	0.797	F8W4A6.pdb.gz
4	AFDB:P16047	0.853	0.856	1.159E-53	412	0.560	0.563	P16047.pdb.gz	TGFB3_CHICK Transforming growth factor beta-3 proprotein OS=Gallus gallus OX=9031 GN=TGFB3 PE=2 SV=2
5	AFDB:Q66I23	0.847	0.854	8.483E-51	410	0.558	0.563	Q66I23.pdb.gz	Q66I23_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=wu:fc78g09 PE=2 SV=1
6	AFDB:A5YM40	0.580	0.582	1.634E-46	412	0.553	0.556	A5YM40.pdb.gz	A5YM40_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 GN=TGFB3 PE=2 SV=1
7	AFDB:P01137	0.417	0.442	1.386E-35	390	0.425	0.451	P01137.pdb.gz	TGFB1_HUMAN Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=3
8	AFDB:F1R741	0.740	0.806	1.678E-34	377	0.362	0.398	F1R741.pdb.gz
9	AFDB:P04202	0.397	0.420	3.854E-34	390	0.435	0.462	P04202.pdb.gz	TGFB1_MOUSE Transforming growth factor beta-1 proprotein OS=Mus musculus OX=10090 GN=Tgfb1 PE=1 SV=1
10	AFDB:E9QHW0	0.742	0.804	9.889E-34	379	0.399	0.435	E9QHW0.pdb.gz	E9QHW0_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1b PE=3 SV=1
11	PDB:3rjrC	0.428	0.506	4.591E-27	343	0.420	0.507	3rjrC.pdb.gz
12	PDB:5vqfB	0.407	0.512	1.143E-25	320	0.391	0.506	5vqfB.pdb.gz
13	PDB:5ffoG	0.407	0.544	9.632E-24	297	0.355	0.495	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
14	PDB:7y1rB	0.386	0.501	1.720E-22	308	0.394	0.529	7y1rB.pdb.gz
15	PDB:5ntuA	0.283	0.372	1.400E-17	308	0.225	0.302	5ntuA.pdb.gz
16	PDB:5hlyA	0.266	0.354	8.717E-17	299	0.191	0.264	5hlyA.pdb.gz
17	PDB:5nxsA	0.254	0.352	2.364E-16	290	0.203	0.290	5nxsA.pdb.gz
18	PDB:6umxA	0.260	0.367	3.199E-15	279	0.198	0.294	6umxA.pdb.gz
19	PDB:5nxsB	0.227	0.362	2.683E-11	251	0.184	0.303	5nxsB.pdb.gz
20	PDB:6q2sA	0.167	0.562	2.229E-3	98	0.053	0.224	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2R7T2	0.0	861	414	0.998	0.998	B2R7T2_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	P09858	0.0	858	435	0.990	0.943	TGFB2_PIG Transforming growth factor beta-2 proprotein OS=Sus scrofa OX=9823 GN=TGFB2 PE=1 SV=2
3	P27090	0.0	831	414	0.959	0.959	TGFB2_MOUSE Transforming growth factor beta-2 proprotein OS=Mus musculus OX=10090 GN=Tgfb2 PE=1 SV=2
4	P30371	0.0	736	412	0.901	0.905	TGFB2_CHICK Transforming growth factor beta-2 proprotein OS=Gallus gallus OX=9031 GN=TGFB2 PE=3 SV=1
5	P61812	0.0	862	414	1.000	1.000	TGFB2_HUMAN Transforming growth factor beta-2 proprotein OS=Homo sapiens OX=9606 GN=TGFB2 PE=1 SV=1
6	Q07257	0.0	814	442	0.952	0.891	TGFB2_RAT Transforming growth factor beta-2 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb2 PE=2 SV=2
7	Q6T7C3	0.0	835	442	0.983	0.921	Q6T7C3_RABIT Transforming growth factor beta OS=Oryctolagus cuniculus OX=9986 PE=2 SV=1
8	Q7SZV4	0.0	642	411	0.768	0.774	Q7SZV4_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb2 PE=2 SV=1
9	Q07258	1.41e-164	470	412	0.553	0.556	TGFB3_RAT Transforming growth factor beta-3 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb3 PE=2 SV=2
10	A5YM40	1.59e-164	470	412	0.551	0.553	A5YM40_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 GN=TGFB3 PE=2 SV=1
11	P10600	1.59e-164	470	412	0.551	0.553	TGFB3_HUMAN Transforming growth factor beta-3 proprotein OS=Homo sapiens OX=9606 GN=TGFB3 PE=1 SV=1
12	P17125	4.56e-164	469	410	0.548	0.554	TGFB3_MOUSE Transforming growth factor beta-3 proprotein OS=Mus musculus OX=10090 GN=Tgfb3 PE=1 SV=1
13	P16047	1.35e-161	462	412	0.551	0.553	TGFB3_CHICK Transforming growth factor beta-3 proprotein OS=Gallus gallus OX=9031 GN=TGFB3 PE=2 SV=2
14	Q66I23	1.42e-160	460	410	0.553	0.559	Q66I23_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=wu:fc78g09 PE=2 SV=1
15	P04202	1.22e-102	311	390	0.447	0.474	TGFB1_MOUSE Transforming growth factor beta-1 proprotein OS=Mus musculus OX=10090 GN=Tgfb1 PE=1 SV=1
16	P18341	1.81e-102	311	390	0.437	0.464	TGFB1_BOVIN Transforming growth factor beta-1 proprotein OS=Bos taurus OX=9913 GN=TGFB1 PE=1 SV=2
17	P09531	4.16e-102	310	391	0.423	0.448	TGFB1_CHICK Transforming growth factor beta-1 proprotein OS=Gallus gallus OX=9031 GN=TGFB1 PE=2 SV=3
18	P17246	5.22e-102	310	390	0.440	0.467	TGFB1_RAT Transforming growth factor beta-1 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb1 PE=1 SV=1
19	P09533	5.03e-101	307	390	0.430	0.456	TGFB1_CHLAE Transforming growth factor beta-1 proprotein OS=Chlorocebus aethiops OX=9534 GN=TGFB1 PE=1 SV=1
20	P01137	5.31e-101	307	390	0.430	0.456	TGFB1_HUMAN Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	6.9e-34	129.1	TGF-beta propeptide
2	PF00019 TGF_beta	3.7e-21	87.3	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011799

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007285	0.936	Receptor protein serine/threonine kinase
2	60711.ENSCSAP00000005897	0.912	Transmembrane serine/threonine kinase forming with the TGF- beta type I serine/threonine kinase receptor, TGFBR1, the non- promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of th [...]
3	60711.ENSCSAP00000014035	0.904	Mothers against decapentaplegic homolog
4	60711.ENSCSAP00000009443	0.872	Mothers against decapentaplegic homolog
5	60711.ENSCSAP00000014115	0.840	Mothers against decapentaplegic homolog
6	60711.ENSCSAP00000016563	0.823	Transforming growth factor, beta receptor III
7	60711.ENSCSAP00000009415	0.809	Mothers against decapentaplegic homolog
8	60711.ENSCSAP00000005302	0.799	Amyloid beta (A4) precursor protein
9	60711.ENSCSAP00000014041	0.790	Mothers against decapentaplegic homolog
10	60711.ENSCSAP00000014620	0.779	Mothers against decapentaplegic homolog
11	60711.ENSCSAP00000009511	0.773	Mothers against decapentaplegic homolog
12	60711.ENSCSAP00000002134	0.759	Receptor protein serine/threonine kinase
13	60711.ENSCSAP00000004096	0.758	Latent transforming growth factor beta binding protein 3
14	60711.ENSCSAP00000009996	0.757	Endoglin
15	60711.ENSCSAP00000012006	0.754	Serine/threonine-protein kinase receptor
16	60711.ENSCSAP00000005943	0.750	Bone morphogenetic protein receptor, type IA
17	60711.ENSCSAP00000008494	0.706	Latent transforming growth factor beta binding protein 2
18	60711.ENSCSAP00000007817	0.697	Latent transforming growth factor beta binding protein 1
19	60711.ENSCSAP00000017843	0.697	Jun proto-oncogene, AP-1 transcription factor subunit
20	60711.ENSCSAP00000013306	0.690	Mitogen-activated protein kinase kinase kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005160	1.000	transforming growth factor beta receptor binding
GO:0098772	0.956	molecular function regulator activity
GO:0042802	0.919	identical protein binding
GO:0140677	0.814	molecular function activator activity
GO:0044877	0.607	protein-containing complex binding
GO:0030546	0.593	signaling receptor activator activity
GO:0048018	0.583	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0060485	0.988	mesenchyme development
GO:0050789	0.986	regulation of biological process
GO:0009790	0.986	embryo development
GO:0048731	0.985	system development
GO:0009987	0.984	cellular process
GO:0048523	0.981	negative regulation of cellular process
GO:0009653	0.978	anatomical structure morphogenesis
GO:0009887	0.966	animal organ morphogenesis
GO:0060021	0.958	roof of mouth development
GO:0048518	0.947	positive regulation of biological process
GO:0060429	0.940	epithelium development
GO:0042127	0.936	regulation of cell population proliferation
GO:0072359	0.934	circulatory system development
GO:0042221	0.928	response to chemical
GO:0071704	0.927	organic substance metabolic process
GO:0044238	0.920	primary metabolic process
GO:0044237	0.920	cellular metabolic process
GO:0010718	0.915	positive regulation of epithelial to mesenchymal transition
GO:0007507	0.911	heart development
GO:0009719	0.910	response to endogenous stimulus
GO:0019222	0.905	regulation of metabolic process
GO:0006807	0.903	nitrogen compound metabolic process
GO:0060255	0.901	regulation of macromolecule metabolic process
GO:0031323	0.898	regulation of cellular metabolic process
GO:0080090	0.897	regulation of primary metabolic process
GO:0051171	0.897	regulation of nitrogen compound metabolic process
GO:0010033	0.896	response to organic substance
GO:0048729	0.893	tissue morphogenesis
GO:0009611	0.892	response to wounding
GO:0007167	0.887	enzyme-linked receptor protein signaling pathway
GO:0043170	0.886	macromolecule metabolic process
GO:0003007	0.886	heart morphogenesis
GO:0010604	0.885	positive regulation of macromolecule metabolic process
GO:0009966	0.881	regulation of signal transduction
GO:0048762	0.879	mesenchymal cell differentiation
GO:0031325	0.879	positive regulation of cellular metabolic process
GO:0051173	0.878	positive regulation of nitrogen compound metabolic process
GO:0060537	0.877	muscle tissue development
GO:0071363	0.877	cellular response to growth factor stimulus
GO:0010468	0.876	regulation of gene expression
GO:0007178	0.875	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0003203	0.873	endocardial cushion morphogenesis
GO:0065009	0.867	regulation of molecular function
GO:0001837	0.867	epithelial to mesenchymal transition
GO:2000026	0.866	regulation of multicellular organismal development
GO:0036211	0.865	protein modification process
GO:0009889	0.863	regulation of biosynthetic process
GO:0070887	0.863	cellular response to chemical stimulus
GO:0051246	0.854	regulation of protein metabolic process
GO:0071559	0.850	response to transforming growth factor beta
GO:0007179	0.840	transforming growth factor beta receptor signaling pathway
GO:0009891	0.820	positive regulation of biosynthetic process
GO:0019219	0.815	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.809	regulation of RNA biosynthetic process
GO:0006355	0.802	regulation of DNA-templated transcription
GO:0035295	0.801	tube development
GO:0043009	0.795	chordate embryonic development
GO:0060317	0.791	cardiac epithelial to mesenchymal transition
GO:0061053	0.771	somite development
GO:0008544	0.768	epidermis development
GO:0051254	0.767	positive regulation of RNA metabolic process
GO:0048568	0.766	embryonic organ development
GO:0009605	0.763	response to external stimulus
GO:0045893	0.763	positive regulation of DNA-templated transcription
GO:0043588	0.754	skin development
GO:0048584	0.745	positive regulation of response to stimulus
GO:0002376	0.740	immune system process
GO:0010941	0.738	regulation of cell death
GO:0048646	0.735	anatomical structure formation involved in morphogenesis
GO:0007423	0.730	sensory organ development
GO:0001942	0.729	hair follicle development
GO:0019220	0.725	regulation of phosphate metabolic process
GO:0010628	0.721	positive regulation of gene expression
GO:0071310	0.718	cellular response to organic substance
GO:0031399	0.711	regulation of protein modification process
GO:0048598	0.708	embryonic morphogenesis
GO:0042981	0.705	regulation of apoptotic process
GO:0022414	0.697	reproductive process
GO:0048565	0.688	digestive tract development
GO:0071840	0.667	cellular component organization or biogenesis
GO:0016043	0.633	cellular component organization
GO:0023056	0.627	positive regulation of signaling
GO:0010647	0.618	positive regulation of cell communication
GO:0009967	0.592	positive regulation of signal transduction
GO:0051247	0.586	positive regulation of protein metabolic process
GO:0001501	0.580	skeletal system development
GO:0008285	0.566	negative regulation of cell population proliferation
GO:0008284	0.557	positive regulation of cell population proliferation
GO:0040012	0.548	regulation of locomotion
GO:0032879	0.526	regulation of localization
GO:0048732	0.526	gland development
GO:0048566	0.518	embryonic digestive tract development
GO:0030334	0.515	regulation of cell migration
GO:0007399	0.507	nervous system development
GO:0090092	0.496	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006357	0.493	regulation of transcription by RNA polymerase II
GO:0009892	0.480	negative regulation of metabolic process
GO:0010605	0.474	negative regulation of macromolecule metabolic process
GO:0035239	0.471	tube morphogenesis
GO:0045944	0.471	positive regulation of transcription by RNA polymerase II
GO:0051093	0.469	negative regulation of developmental process
GO:0002682	0.443	regulation of immune system process
GO:0007389	0.439	pattern specification process
GO:0051128	0.419	regulation of cellular component organization
GO:1902531	0.402	regulation of intracellular signal transduction
GO:0040008	0.389	regulation of growth
GO:0048468	0.387	cell development
GO:0030335	0.375	positive regulation of cell migration
GO:0061061	0.332	muscle structure development
GO:1901700	0.323	response to oxygen-containing compound
GO:0060322	0.322	head development
GO:0009725	0.315	response to hormone
GO:0090100	0.302	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.996	extracellular space
GO:0043226	0.977	organelle
GO:0005622	0.975	intracellular anatomical structure
GO:0043227	0.972	membrane-bounded organelle
GO:0012505	0.957	endomembrane system
GO:0032991	0.951	protein-containing complex
GO:0005737	0.945	cytoplasm
GO:0071944	0.934	cell periphery
GO:0043229	0.908	intracellular organelle
GO:0043231	0.888	intracellular membrane-bounded organelle
GO:0031982	0.684	vesicle
GO:0005886	0.621	plasma membrane
GO:0070013	0.570	intracellular organelle lumen
GO:0099503	0.534	secretory vesicle
GO:0030141	0.523	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]