StarFunc result for job id P61923

User Input

>input (177 residues)
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIA
LLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEG
LFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QFP1	0.939	0.842	1.055E-31	198	0.927	0.828	F1QFP1.pdb.gz
2	AFDB:Q9P299	0.826	0.698	3.777E-27	210	0.723	0.610	Q9P299.pdb.gz	COPZ2_HUMAN Coatomer subunit zeta-2 OS=Homo sapiens OX=9606 GN=COPZ2 PE=2 SV=1
3	AFDB:Q9VV89	0.872	0.887	4.532E-24	174	0.588	0.598	Q9VV89.pdb.gz	Q9VV89_DROME Coatomer subunit zeta OS=Drosophila melanogaster OX=7227 GN=zetaCOP PE=1 SV=2
4	AFDB:O17901	0.812	0.782	1.753E-21	184	0.537	0.516	O17901.pdb.gz	COPZ_CAEEL Probable coatomer subunit zeta OS=Caenorhabditis elegans OX=6239 GN=copz-1 PE=3 SV=1
5	PDB:5a1uF	0.709	0.891	2.539E-20	139	0.763	0.971	5a1uF.pdb.gz
6	AFDB:Q940S5	0.877	0.877	2.320E-19	177	0.424	0.424	Q940S5.pdb.gz	COPZ1_ARATH Coatomer subunit zeta-1 OS=Arabidopsis thaliana OX=3702 GN=At1g60970 PE=2 SV=1
7	AFDB:Q8H1F4	0.824	0.806	3.967E-19	181	0.429	0.420	Q8H1F4.pdb.gz	COPZ3_ARATH Coatomer subunit zeta-3 OS=Arabidopsis thaliana OX=3702 GN=At4g08520 PE=2 SV=1
8	AFDB:P53600	0.781	0.733	3.260E-17	189	0.379	0.354	P53600.pdb.gz	COPZ_YEAST Coatomer subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET3 PE=1 SV=1
9	AFDB:O74891	0.761	0.710	1.629E-16	190	0.379	0.353	O74891.pdb.gz	COPZ_SCHPO Probable coatomer subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ret3 PE=3 SV=1
10	AFDB:Q38BH3	0.770	0.747	2.156E-14	183	0.254	0.246	Q38BH3.pdb.gz	Q38BH3_TRYB2 Coatomer subunit zeta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2980 PE=3 SV=1
11	AFDB:Q9P7N2	0.698	0.757	1.217E-10	162	0.181	0.198	Q9P7N2.pdb.gz	AP1S1_SCHPO AP-1 complex subunit sigma-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vas2 PE=1 SV=1
12	PDB:1w63Q	0.667	0.785	2.676E-9	148	0.181	0.216	1w63Q.pdb.gz
13	PDB:7p3xS	0.684	0.717	8.810E-9	168	0.186	0.196	7p3xS.pdb.gz
14	PDB:2jkrS	0.684	0.838	1.337E-8	142	0.153	0.190	2jkrS.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
15	PDB:4hmyS	0.656	0.785	4.959E-8	145	0.209	0.255	4hmyS.pdb.gz	Structural Basis for Recruitment and Activation of the AP-1 Clathrin Adaptor Complex by Arf1.
16	PDB:7rwaM	0.585	0.291	1.571E-6	379	0.107	0.050	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.
17	PDB:2jkrM	0.629	0.291	4.872E-6	409	0.113	0.049	2jkrM.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
18	PDB:5nzuD	0.592	0.276	7.394E-6	427	0.181	0.075	5nzuD.pdb.gz
19	PDB:6cm9M	0.583	0.269	1.918E-5	415	0.130	0.055	6cm9M.pdb.gz	HIV-1 Nefs Are Cargo-Sensitive AP-1 Trimerization Switches in Tetherin Downregulation.
20	PDB:1w63M	0.586	0.290	8.506E-5	388	0.130	0.059	1w63M.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61923	6.35e-129	360	177	1.000	1.000	COPZ1_HUMAN Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 PE=1 SV=1
2	P61924	6.35e-129	360	177	1.000	1.000	COPZ1_MOUSE Coatomer subunit zeta-1 OS=Mus musculus OX=10090 GN=Copz1 PE=1 SV=1
3	P35604	2.83e-128	358	177	0.994	0.994	COPZ1_BOVIN Coatomer subunit zeta-1 OS=Bos taurus OX=9913 GN=COPZ1 PE=1 SV=2
4	Q9IB48	8.74e-123	345	177	0.932	0.932	Q9IB48_DANRE Coatomer subunit zeta OS=Danio rerio OX=7955 GN=CHUNP6876 PE=1 SV=1
5	Q9P299	2.89e-94	274	210	0.723	0.610	COPZ2_HUMAN Coatomer subunit zeta-2 OS=Homo sapiens OX=9606 GN=COPZ2 PE=2 SV=1
6	Q9VV89	2.32e-79	235	174	0.588	0.598	Q9VV89_DROME Coatomer subunit zeta OS=Drosophila melanogaster OX=7227 GN=zetaCOP PE=1 SV=2
7	Q8IQP2	2.22e-78	232	163	0.582	0.632	Q8IQP2_DROME Coatomer subunit zeta OS=Drosophila melanogaster OX=7227 GN=zetaCOP PE=1 SV=1
8	Q8IQP1	5.09e-70	211	169	0.531	0.556	Q8IQP1_DROME Coatomer subunit zeta OS=Drosophila melanogaster OX=7227 GN=zetaCOP PE=1 SV=1
9	O17901	4.02e-66	202	184	0.542	0.522	COPZ_CAEEL Probable coatomer subunit zeta OS=Caenorhabditis elegans OX=6239 GN=copz-1 PE=3 SV=1
10	Q940S5	9.09e-48	155	177	0.429	0.429	COPZ1_ARATH Coatomer subunit zeta-1 OS=Arabidopsis thaliana OX=3702 GN=At1g60970 PE=2 SV=1
11	Q8H1F4	7.16e-43	142	181	0.429	0.420	COPZ3_ARATH Coatomer subunit zeta-3 OS=Arabidopsis thaliana OX=3702 GN=At4g08520 PE=2 SV=1
12	P53600	7.61e-33	117	189	0.345	0.323	COPZ_YEAST Coatomer subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET3 PE=1 SV=1
13	O74891	2.63e-31	113	190	0.345	0.321	COPZ_SCHPO Probable coatomer subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ret3 PE=3 SV=1
14	Q38BH3	9.62e-19	80.9	183	0.237	0.230	Q38BH3_TRYB2 Coatomer subunit zeta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2980 PE=3 SV=1
15	H0YN38	4.16e-06	46.6	156	0.186	0.212	H0YN38_HUMAN AP complex subunit sigma OS=Homo sapiens OX=9606 GN=AP3S2 PE=1 SV=1
16	O82201	5.72e-06	46.2	143	0.186	0.231	AP4S_ARATH AP-4 complex subunit sigma OS=Arabidopsis thaliana OX=3702 GN=At2g19790 PE=1 SV=1
17	P59780	7.20e-06	46.6	193	0.186	0.171	AP3S2_HUMAN AP-3 complex subunit sigma-2 OS=Homo sapiens OX=9606 GN=AP3S2 PE=2 SV=1
18	Q8BSZ2	7.20e-06	46.6	193	0.186	0.171	AP3S2_MOUSE AP-3 complex subunit sigma-2 OS=Mus musculus OX=10090 GN=Ap3s2 PE=1 SV=1
19	C0HLF1	1.64e-05	45.1	154	0.215	0.247	TSTD_DICDI TSET complex member tstD OS=Dictyostelium discoideum OX=44689 GN=tstD PE=1 SV=1
20	Q96PC3	2.55e-05	44.7	154	0.249	0.286	AP1S3_HUMAN AP-1 complex subunit sigma-3 OS=Homo sapiens OX=9606 GN=AP1S3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01217 Clat_adaptor_s	2.6e-42	155.6	Clathrin adaptor complex small chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008837354.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008822746.1	0.997	Coatomer protein complex subunit epsilon
2	1026970.XP_008826767.1	0.997	Coatomer protein complex subunit gamma 1
3	1026970.XP_008839026.1	0.997	Coatomer subunit alpha isoform X1
4	1026970.XP_008849102.1	0.997	Archain 1
5	1026970.XP_008851741.1	0.996	Coatomer subunit beta
6	1026970.XP_008819714.1	0.976	Coatomer subunit beta'-like
7	1026970.XP_008835544.1	0.976	Coatomer subunit beta'-like
8	1026970.XP_008842325.1	0.976	Coatomer protein complex subunit beta 2
9	1026970.XP_008844630.1	0.972	Coatomer protein complex subunit gamma 2
10	1026970.XP_008849087.1	0.972	Coatomer subunit gamma-2-like
11	1026970.XP_008820407.1	0.883	SCY1 like pseudokinase 1
12	1026970.XP_008836491.1	0.876	Coatomer protein complex subunit zeta 2
13	1026970.XP_008823483.1	0.870	Toll like receptor adaptor molecule 2
14	1026970.XP_008828741.1	0.839	SEC22 homolog B, vesicle trafficking protein
15	1026970.XP_008832208.1	0.784	AP-4 complex subunit beta-1 isoform X1
16	1026970.XP_008841176.1	0.780	Vesicle-trafficking protein SEC22a
17	1026970.XP_008844006.1	0.774	Conserved oligomeric Golgi complex subunit 2
18	1026970.XP_008841480.1	0.768	ADP ribosylation factor GTPase activating protein 1
19	1026970.XP_008820780.1	0.755	Bet1 golgi vesicular membrane trafficking protein
20	1026970.XP_008822222.1	0.738	KDEL endoplasmic reticulum protein retention receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060090	0.306	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048193	0.980	Golgi vesicle transport
GO:0006890	0.909	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006891	0.892	intra-Golgi vesicle-mediated transport
GO:0009987	0.490	cellular process
GO:0032501	0.413	multicellular organismal process
GO:0032502	0.412	developmental process
GO:0048856	0.404	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005794	1.000	Golgi apparatus
GO:0031410	1.000	cytoplasmic vesicle
GO:0098588	0.997	bounding membrane of organelle
GO:0030126	0.987	COPI vesicle coat
GO:0005829	0.891	cytosol
GO:0031984	0.575	organelle subcompartment
GO:0005783	0.540	endoplasmic reticulum
GO:0000139	0.476	Golgi membrane
GO:0042175	0.332	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.322	endoplasmic reticulum subcompartment
GO:0005789	0.314	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]