StarFunc result for job id P61925

User Input

>input (76 residues)
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS
TEQSGEAQGEAAKSES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61925	1.000	1.000	2.990E-12	76	1.000	1.000	P61925.pdb.gz	IPKA_HUMAN cAMP-dependent protein kinase inhibitor alpha OS=Homo sapiens OX=9606 GN=PKIA PE=1 SV=2
2	AFDB:Q9C010	0.185	0.182	1.648E-2	78	0.342	0.333	Q9C010.pdb.gz	IPKB_HUMAN cAMP-dependent protein kinase inhibitor beta OS=Homo sapiens OX=9606 GN=PKIB PE=1 SV=1
3	AFDB:O70139	0.303	0.303	3.092E-2	76	0.342	0.342	O70139.pdb.gz	IPKG_MOUSE cAMP-dependent protein kinase inhibitor gamma OS=Mus musculus OX=10090 GN=Pkig PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61925	3.31e-49	151	76	1.000	1.000	IPKA_HUMAN cAMP-dependent protein kinase inhibitor alpha OS=Homo sapiens OX=9606 GN=PKIA PE=1 SV=2
2	P61926	3.31e-49	151	76	1.000	1.000	IPKA_RABIT cAMP-dependent protein kinase inhibitor alpha OS=Oryctolagus cuniculus OX=9986 GN=PKIA PE=1 SV=2
3	P63248	7.41e-48	147	76	0.974	0.974	IPKA_MOUSE cAMP-dependent protein kinase inhibitor alpha OS=Mus musculus OX=10090 GN=Pkia PE=1 SV=2
4	P63249	7.41e-48	147	76	0.974	0.974	IPKA_RAT cAMP-dependent protein kinase inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Pkia PE=1 SV=2
5	Q9C010	2.60e-10	53.1	78	0.368	0.359	IPKB_HUMAN cAMP-dependent protein kinase inhibitor beta OS=Homo sapiens OX=9606 GN=PKIB PE=1 SV=1
6	Q04758	4.66e-09	50.1	92	0.368	0.304	IPKB_MOUSE cAMP-dependent protein kinase inhibitor beta OS=Mus musculus OX=10090 GN=Pkib PE=3 SV=1
7	O70139	2.05e-07	45.4	76	0.342	0.342	IPKG_MOUSE cAMP-dependent protein kinase inhibitor gamma OS=Mus musculus OX=10090 GN=Pkig PE=1 SV=1
8	Q549H9	4.11e-07	44.7	76	0.289	0.289	Q549H9_HUMAN cAMP-dependent protein kinase inhibitor OS=Homo sapiens OX=9606 GN=PKIG PE=1 SV=1
9	Q9Y2B9	4.11e-07	44.7	76	0.289	0.289	IPKG_HUMAN cAMP-dependent protein kinase inhibitor gamma OS=Homo sapiens OX=9606 GN=PKIG PE=1 SV=1
10	F7F4X2	1.40e-06	45.4	200	0.342	0.130	F7F4X2_RAT cAMP-dependent protein kinase inhibitor gamma OS=Rattus norvegicus OX=10116 GN=Pkig PE=1 SV=1
11	A0A0G2K0Y8	0.001	35.8	67	0.237	0.269	A0A0G2K0Y8_RAT Uncharacterized protein OS=Rattus norvegicus OX=10116 GN=ENSRNOG00000068283 PE=1 SV=1
12	Q9VXG8	0.94	29.6	2517	0.224	0.007	ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster OX=7227 GN=mei-41 PE=1 SV=2
13	A0A087WYX0	2.1	28.5	524	0.197	0.029	A0A087WYX0_HUMAN CEA cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
14	A0A024R0K5	2.8	28.1	702	0.197	0.021	A0A024R0K5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1
15	P06731	2.8	28.1	702	0.197	0.021	CEAM5_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=4
16	F0QRW4	3.7	27.7	540	0.276	0.039	F0QRW4_MYCSL Enolase OS=Mycoplasma suis (strain Illinois) OX=768700 GN=eno PE=3 SV=1
17	O06359	8.7	26.6	771	0.289	0.029	O06359_MYCTU Probable helicase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3649 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02827 PKI	7.6e-27	104.8	cAMP-dependent protein kinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002417

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016255	0.999	Protein kinase, cAMP-dependent, catalytic, alpha
2	61853.ENSNLEP00000012062	0.979	Belongs to the protein kinase superfamily.
3	61853.ENSNLEP00000024421	0.925	Exportin 1
4	61853.ENSNLEP00000010408	0.731	Belongs to the protein kinase superfamily.
5	61853.ENSNLEP00000010208	0.691	ALK and LTK ligand 2
6	61853.ENSNLEP00000001921	0.643	Plexin A2
7	61853.ENSNLEP00000014306	0.643	Catenin delta 2
8	61853.ENSNLEP00000003112	0.637	Inositol-1-monophosphatase
9	61853.ENSNLEP00000014598	0.606	CUGBP, Elav-like family member 2
10	61853.ENSNLEP00000002080	0.604	Hydroxysteroid (11-beta) dehydrogenase 1
11	61853.ENSNLEP00000021951	0.580	Nuclear receptor subfamily 5, group A, member 2
12	61853.ENSNLEP00000013704	0.559	Uncharacterized protein
13	61853.ENSNLEP00000024425	0.559	Uncharacterized protein
14	61853.ENSNLEP00000021803	0.554	Proline rich 5 like
15	61853.ENSNLEP00000004080	0.532	Neurocalcin delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004862	1.000	cAMP-dependent protein kinase inhibitor activity
GO:0034236	1.000	protein kinase A catalytic subunit binding
GO:0140678	0.995	molecular function inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.999	regulation of primary metabolic process
GO:0060255	0.999	regulation of macromolecule metabolic process
GO:0051338	0.999	regulation of transferase activity
GO:0051171	0.999	regulation of nitrogen compound metabolic process
GO:0031323	0.999	regulation of cellular metabolic process
GO:0006469	0.987	negative regulation of protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.346	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]