StarFunc result for job id P61956

User Input

>input (95 residues)
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z172	0.826	0.719	1.287E-18	110	0.947	0.818	Q9Z172.pdb.gz	SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus OX=10090 GN=Sumo3 PE=1 SV=1
2	AFDB:Q6EEV6	0.952	0.952	4.918E-18	95	0.863	0.863	Q6EEV6.pdb.gz	SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens OX=9606 GN=SUMO4 PE=1 SV=3
3	PDB:1wz0A	0.780	0.717	1.391E-15	104	0.968	0.885	1wz0A.pdb.gz
4	AFDB:O97102	0.850	0.896	2.867E-15	90	0.674	0.711	O97102.pdb.gz	O97102_DROME Small ubiquitin-related modifier OS=Drosophila melanogaster OX=7227 GN=Sumo PE=1 SV=1
5	AFDB:P55853	0.820	0.855	1.001E-13	91	0.453	0.473	P55853.pdb.gz	SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans OX=6239 GN=smo-1 PE=1 SV=1
6	AFDB:Q8N0B4	0.821	0.796	1.308E-13	98	0.537	0.520	Q8N0B4.pdb.gz	Q8N0B4_DICDI Small ubiquitin-like protein OS=Dictyostelium discoideum OX=44689 GN=SUMO PE=2 SV=1
7	AFDB:G2XKQ0	0.813	0.766	1.399E-13	101	0.453	0.426	G2XKQ0.pdb.gz	SUMO5_HUMAN Small ubiquitin-related modifier 5 OS=Homo sapiens OX=9606 GN=SUMO1P1 PE=1 SV=2
8	AFDB:O57686	0.821	0.767	1.829E-13	102	0.453	0.422	O57686.pdb.gz	SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis OX=8355 GN=sumo1-a PE=1 SV=1
9	AFDB:Q8I444	0.777	0.740	3.127E-13	100	0.495	0.470	Q8I444.pdb.gz	Q8I444_PLAF7 Small ubiquitin-related modifier OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0505800 PE=4 SV=1
10	AFDB:Q7SZR5	0.849	0.808	7.474E-13	100	0.463	0.440	Q7SZR5.pdb.gz	SUMO1_DANRE Small ubiquitin-related modifier 1 OS=Danio rerio OX=7955 GN=sumo1 PE=3 SV=1
11	AFDB:P55852	0.866	0.826	7.993E-13	100	0.474	0.450	P55852.pdb.gz	SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana OX=3702 GN=SUMO1 PE=1 SV=2
12	PDB:2k1fA	0.666	0.710	4.633E-12	88	0.632	0.682	2k1fA.pdb.gz
13	PDB:5xqmA	0.708	0.743	2.647E-11	90	0.442	0.467	5xqmA.pdb.gz
14	PDB:3pgeA	0.744	0.422	2.585E-10	172	0.389	0.215	3pgeA.pdb.gz
15	PDB:6rpqA	0.757	0.299	1.381E-9	249	0.389	0.149	6rpqA.pdb.gz
16	PDB:3tixA	0.750	0.474	2.208E-9	153	0.379	0.235	3tixA.pdb.gz
17	PDB:1a5rA	0.630	0.589	4.936E-9	103	0.484	0.447	1a5rA.pdb.gz
18	PDB:6mdhA	0.710	0.464	1.764E-8	149	0.116	0.074	6mdhA.pdb.gz
19	PDB:3dbhI	0.705	0.770	3.225E-8	86	0.147	0.163	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:7rbsB	0.734	0.457	6.741E-8	157	0.105	0.064	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61956	7.84e-68	199	95	1.000	1.000	SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 PE=1 SV=3
2	P61957	7.84e-68	199	95	1.000	1.000	SUMO2_MOUSE Small ubiquitin-related modifier 2 OS=Mus musculus OX=10090 GN=Sumo2 PE=1 SV=1
3	P61959	7.84e-68	199	95	1.000	1.000	SUMO2_RAT Small ubiquitin-related modifier 2 OS=Rattus norvegicus OX=10116 GN=Sumo2 PE=1 SV=1
4	Q6DHL4	2.16e-65	193	96	0.968	0.958	SUMO2_DANRE Small ubiquitin-related modifier 2 OS=Danio rerio OX=7955 GN=sumo2 PE=3 SV=1
5	P55854	6.67e-63	187	103	0.958	0.883	SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens OX=9606 GN=SUMO3 PE=1 SV=2
6	Q9Z172	6.78e-62	185	110	0.947	0.818	SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus OX=10090 GN=Sumo3 PE=1 SV=1
7	Q6NV25	6.97e-61	182	94	0.926	0.936	SMO3L_DANRE Small ubiquitin-related modifier 3-like OS=Danio rerio OX=7955 GN=sumo3l PE=3 SV=1
8	Q6EEV6	1.64e-55	168	95	0.853	0.853	SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens OX=9606 GN=SUMO4 PE=1 SV=3
9	O97102	1.05e-41	133	90	0.695	0.733	O97102_DROME Small ubiquitin-related modifier OS=Drosophila melanogaster OX=7227 GN=Sumo PE=1 SV=1
10	Q8N0B4	5.42e-27	96.7	98	0.537	0.520	Q8N0B4_DICDI Small ubiquitin-like protein OS=Dictyostelium discoideum OX=44689 GN=SUMO PE=2 SV=1
11	P55853	2.59e-26	94.7	91	0.453	0.473	SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans OX=6239 GN=smo-1 PE=1 SV=1
12	A7WLH8	1.16e-24	90.9	101	0.432	0.406	SUMO1_PIG Small ubiquitin-related modifier 1 OS=Sus scrofa OX=9823 GN=SUMO1 PE=3 SV=1
13	P63165	1.16e-24	90.9	101	0.432	0.406	SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
14	P63166	1.16e-24	90.9	101	0.432	0.406	SUMO1_MOUSE Small ubiquitin-related modifier 1 OS=Mus musculus OX=10090 GN=Sumo1 PE=1 SV=1
15	Q5I0H3	1.16e-24	90.9	101	0.432	0.406	SUMO1_RAT Small ubiquitin-related modifier 1 OS=Rattus norvegicus OX=10116 GN=Sumo1 PE=1 SV=1
16	G2XKQ0	2.41e-24	90.1	101	0.453	0.426	SUMO5_HUMAN Small ubiquitin-related modifier 5 OS=Homo sapiens OX=9606 GN=SUMO1P1 PE=1 SV=2
17	O57686	3.26e-24	89.7	102	0.453	0.422	SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis OX=8355 GN=sumo1-a PE=1 SV=1
18	O13351	6.60e-24	89.4	117	0.463	0.376	PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmt3 PE=1 SV=2
19	P55852	1.01e-23	88.6	100	0.484	0.460	SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana OX=3702 GN=SUMO1 PE=1 SV=2
20	Q57Z72	2.09e-23	88.2	114	0.432	0.360	Q57Z72_TRYB2 Small ubiquitin protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.260 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18099 DUF5010_C	3.6e+02	12.8	DUF5010 C-terminal domain
2	PF11976 Rad60-SLD	1.6e-22	90.4	Ubiquitin-2 like Rad60 SUMO-like
3	PF00240 ubiquitin	4.9e-09	47.2	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000026529

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000014138	0.979	Proliferating cell nuclear antigen
2	9361.ENSDNOP00000033522	0.963	RAN binding protein 2
3	9361.ENSDNOP00000007075	0.958	SUMO1/sentrin specific peptidase 1
4	9361.ENSDNOP00000015778	0.957	SUMO1 activating enzyme subunit 1
5	9361.ENSDNOP00000009979	0.953	Ubiquitin-like modifier activating enzyme 2
6	9361.ENSDNOP00000026674	0.952	annotation not available
7	9361.ENSDNOP00000028287	0.952	annotation not available
8	9361.ENSDNOP00000033389	0.952	Ran GTPase activating protein 1
9	9361.ENSDNOP00000007737	0.948	CREB binding protein
10	9361.ENSDNOP00000024414	0.948	Protein inhibitor of activated STAT, 4
11	9361.ENSDNOP00000008311	0.946	Ubiquitin interaction motif containing 1
12	9361.ENSDNOP00000010567	0.945	Protein inhibitor of activated STAT, 1
13	9361.ENSDNOP00000032161	0.944	Ring finger protein 4
14	9361.ENSDNOP00000007725	0.943	RAD52 homolog (S. cerevisiae)
15	9361.ENSDNOP00000007879	0.942	Bloom syndrome, RecQ helicase-like
16	9361.ENSDNOP00000014802	0.938	SUMO1/sentrin/SMT3 specific peptidase 2
17	9361.ENSDNOP00000008503	0.937	Protein inhibitor of activated STAT, 3
18	9361.ENSDNOP00000016845	0.936	Structural maintenance of chromosomes 5
19	9361.ENSDNOP00000010638	0.935	thymine-DNA glycosylase
20	9361.ENSDNOP00000009195	0.931	Protein inhibitor of activated STAT, 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.554	catalytic activity
GO:1901363	0.455	heterocyclic compound binding
GO:0097159	0.451	organic cyclic compound binding
GO:0003676	0.404	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0009987	0.992	cellular process
GO:0043170	0.991	macromolecule metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0080090	0.983	regulation of primary metabolic process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0048518	0.969	positive regulation of biological process
GO:0031323	0.935	regulation of cellular metabolic process
GO:0016925	0.931	protein sumoylation
GO:0019219	0.776	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.760	positive regulation of cellular process
GO:0009893	0.741	positive regulation of metabolic process
GO:0051173	0.719	positive regulation of nitrogen compound metabolic process
GO:0009889	0.699	regulation of biosynthetic process
GO:0010604	0.692	positive regulation of macromolecule metabolic process
GO:0051252	0.685	regulation of RNA metabolic process
GO:0031325	0.683	positive regulation of cellular metabolic process
GO:0010468	0.617	regulation of gene expression
GO:0051246	0.617	regulation of protein metabolic process
GO:0031326	0.600	regulation of cellular biosynthetic process
GO:0010556	0.599	regulation of macromolecule biosynthetic process
GO:2001141	0.571	regulation of RNA biosynthetic process
GO:1903506	0.553	regulation of nucleic acid-templated transcription
GO:0006355	0.544	regulation of DNA-templated transcription
GO:0048519	0.392	negative regulation of biological process
GO:0048856	0.377	anatomical structure development
GO:0032501	0.374	multicellular organismal process
GO:0048523	0.341	negative regulation of cellular process
GO:0051247	0.321	positive regulation of protein metabolic process
GO:0050896	0.317	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.927	protein-containing complex
GO:0005737	0.689	cytoplasm
GO:0016604	0.571	nuclear body
GO:0043232	0.523	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]