StarFunc result for job id P61962

User Input

>input (342 residues)
MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFI
CRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFC
APLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDI
AFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATM
AMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMP
RAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61962	1.000	1.000	8.101E-74	342	1.000	1.000	P61962.pdb.gz	DCAF7_HUMAN DDB1- and CUL4-associated factor 7 OS=Homo sapiens OX=9606 GN=DCAF7 PE=1 SV=1
2	AFDB:Q9VR53	0.986	0.983	4.870E-64	343	0.860	0.857	Q9VR53.pdb.gz	Q9VR53_DROME LD15927p OS=Drosophila melanogaster OX=7227 GN=wap PE=1 SV=2
3	AFDB:Q93759	0.973	0.699	1.549E-55	478	0.637	0.456	Q93759.pdb.gz	Q93759_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=swan-2 PE=1 SV=2
4	AFDB:Q8L4X6	0.916	0.905	1.020E-47	346	0.594	0.587	Q8L4X6.pdb.gz	Q8L4X6_GOSHI WD-repeat protein GhTTG2 OS=Gossypium hirsutum OX=3635 PE=2 SV=1
5	AFDB:Q93758	0.956	0.845	3.595E-47	388	0.520	0.459	Q93758.pdb.gz	Q93758_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=swan-1 PE=1 SV=1
6	AFDB:Q38960	0.930	0.919	1.202E-46	346	0.567	0.561	Q38960.pdb.gz	LWD2_ARATH WD repeat-containing protein LWD2 OS=Arabidopsis thaliana OX=3702 GN=LWD2 PE=2 SV=1
7	AFDB:Q8LJT0	0.894	0.887	5.623E-43	345	0.544	0.539	Q8LJT0.pdb.gz	Q8LJT0_GOSHI Protein TRANSPARENT TESTA GLABRA 1 OS=Gossypium hirsutum OX=3635 GN=LOC107938089 PE=4 SV=1
8	AFDB:Q9XGN1	0.895	0.897	1.002E-42	341	0.518	0.519	Q9XGN1.pdb.gz	TTG1_ARATH Protein TRANSPARENT TESTA GLABRA 1 OS=Arabidopsis thaliana OX=3702 GN=TTG1 PE=1 SV=1
9	AFDB:Q8L5J3	0.892	0.890	3.720E-42	343	0.544	0.542	Q8L5J3.pdb.gz	Q8L5J3_GOSHI WD-repeat protein GhTTG1 OS=Gossypium hirsutum OX=3635 PE=2 SV=1
10	AFDB:Q38E80	0.880	0.833	7.617E-37	362	0.395	0.373	Q38E80.pdb.gz	Q38E80_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0770 PE=4 SV=1
11	PDB:6s29C	0.772	0.676	2.457E-20	394	0.213	0.185	6s29C.pdb.gz
12	PDB:2ybaB	0.757	0.683	4.377E-20	382	0.173	0.154	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
13	PDB:3cfvB	0.767	0.674	9.619E-20	393	0.167	0.145	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
14	PDB:4pswB	0.773	0.727	1.068E-19	366	0.181	0.169	4pswB.pdb.gz	Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
15	PDB:3w15A	0.748	0.761	9.685E-19	336	0.199	0.202	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
16	PDB:6zrdA	0.750	0.631	2.916E-18	411	0.184	0.153	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
17	PDB:3gfcA	0.742	0.748	1.564E-17	339	0.175	0.177	3gfcA.pdb.gz
18	PDB:7tdzD	0.740	0.680	7.552E-17	375	0.170	0.155	7tdzD.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
19	PDB:7r5jQ0	0.748	0.742	1.749E-16	345	0.167	0.165	7r5jQ0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:7fikc	0.723	0.795	2.805E-16	309	0.161	0.178	7fikc.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61962	0.0	718	342	1.000	1.000	DCAF7_HUMAN DDB1- and CUL4-associated factor 7 OS=Homo sapiens OX=9606 GN=DCAF7 PE=1 SV=1
2	Q7T3E0	0.0	708	342	0.980	0.980	Q7T3E0_DANRE DDB1- and CUL4-associated factor 7 OS=Danio rerio OX=7955 GN=wdr68 PE=1 SV=1
3	Q9VR53	0.0	619	343	0.857	0.854	Q9VR53_DROME LD15927p OS=Drosophila melanogaster OX=7227 GN=wap PE=1 SV=2
4	Q93759	4.30e-167	476	478	0.632	0.452	Q93759_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=swan-2 PE=1 SV=2
5	Q8L4X6	7.74e-144	412	346	0.596	0.590	Q8L4X6_GOSHI WD-repeat protein GhTTG2 OS=Gossypium hirsutum OX=3635 PE=2 SV=1
6	Q8LJS9	1.03e-142	409	346	0.591	0.584	Q8LJS9_GOSHI WD repeat-containing protein LWD1-like OS=Gossypium hirsutum OX=3635 GN=LOC107910594 PE=4 SV=1
7	Q9LPV9	5.94e-141	404	346	0.591	0.584	LWD1_ARATH WD repeat-containing protein LWD1 OS=Arabidopsis thaliana OX=3702 GN=LWD1 PE=2 SV=1
8	Q38960	1.69e-137	395	346	0.573	0.566	LWD2_ARATH WD repeat-containing protein LWD2 OS=Arabidopsis thaliana OX=3702 GN=LWD2 PE=2 SV=1
9	Q93758	1.99e-127	372	388	0.520	0.459	Q93758_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=swan-1 PE=1 SV=1
10	Q8L5J3	1.97e-116	342	343	0.535	0.534	Q8L5J3_GOSHI WD-repeat protein GhTTG1 OS=Gossypium hirsutum OX=3635 PE=2 SV=1
11	Q9XGN1	1.57e-115	340	341	0.520	0.522	TTG1_ARATH Protein TRANSPARENT TESTA GLABRA 1 OS=Arabidopsis thaliana OX=3702 GN=TTG1 PE=1 SV=1
12	Q8LJT0	3.94e-115	339	345	0.535	0.530	Q8LJT0_GOSHI Protein TRANSPARENT TESTA GLABRA 1 OS=Gossypium hirsutum OX=3635 GN=LOC107938089 PE=4 SV=1
13	Q95T24	1.33e-95	282	153	0.392	0.876	Q95T24_DROME LD21275p OS=Drosophila melanogaster OX=7227 GN=wap PE=2 SV=1
14	Q38E80	6.43e-82	254	362	0.404	0.381	Q38E80_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0770 PE=4 SV=1
15	Q12523	1.57e-53	186	523	0.345	0.226	YP247_YEAST WD repeat-containing protein YPL247C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPL247C PE=1 SV=1
16	O14021	5.04e-10	62.8	431	0.216	0.172	PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prw1 PE=1 SV=1
17	Q57W97	6.99e-10	62.0	361	0.187	0.177	Q57W97_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.1010 PE=3 SV=1
18	Q9XF57	7.82e-09	58.5	317	0.152	0.164	PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana OX=3702 GN=PEX7 PE=1 SV=2
19	Q4VQ66	9.57e-09	58.5	373	0.164	0.150	Q4VQ66_LEIMA Small ribosomal subunit protein RACK1 OS=Leishmania major OX=5664 GN=PEX7 PE=2 SV=1
20	Q9P783	1.36e-08	58.5	480	0.149	0.106	RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00400 WD40	0.013	27.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005402263.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005375804.1	0.981	Dual specificity tyrosine-phosphorylation-regulated kinase 1A isoform X1
2	34839.XP_005408220.1	0.953	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 24 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
3	34839.XP_005377103.1	0.949	DDB1- and CUL4-associated factor 11 isoform X1
4	34839.XP_005392710.1	0.946	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
5	34839.XP_005409496.1	0.940	DDB1- and CUL4-associated factor 4
6	34839.XP_005414142.1	0.932	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
7	34839.XP_005409582.1	0.915	DET1- and DDB1-associated protein 1 isoform X1
8	34839.XP_005374279.1	0.914	cullin-4A
9	34839.XP_005394953.1	0.912	WD and tetratricopeptide repeats protein 1 isoform X1
10	34839.XP_005398278.1	0.912	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
11	34839.XP_005413713.1	0.912	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
12	34839.XP_005381132.1	0.911	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
13	34839.XP_005382919.1	0.911	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
14	34839.XP_005399099.1	0.902	DDB1- and CUL4-associated factor 5 isoform X1
15	34839.XP_005381630.1	0.901	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	34839.XP_005383980.1	0.901	Protein cereblon
17	34839.XP_005410369.1	0.901	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 6 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
18	34839.XP_005379395.1	0.853	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 2 ESTs, 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
19	34839.XP_005395878.1	0.853	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins, and 55% coverage of the annotated genomic feature by RNAseq alignments
20	34839.XP_005400256.1	0.825	DDB1- and CUL4-associated factor 8 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.992	developmental process
GO:0009987	0.982	cellular process
GO:0032501	0.971	multicellular organismal process
GO:0048856	0.968	anatomical structure development
GO:0050789	0.927	regulation of biological process
GO:0007275	0.910	multicellular organism development
GO:0050794	0.897	regulation of cellular process
GO:0048731	0.872	system development
GO:0048704	0.702	embryonic skeletal system morphogenesis
GO:1904888	0.701	cranial skeletal system development
GO:0048701	0.667	embryonic cranial skeleton morphogenesis
GO:0048703	0.606	embryonic viscerocranium morphogenesis
GO:0061448	0.545	connective tissue development
GO:0048869	0.536	cellular developmental process
GO:0030154	0.521	cell differentiation
GO:0048518	0.480	positive regulation of biological process
GO:0061061	0.399	muscle structure development
GO:0008152	0.362	metabolic process
GO:0048523	0.319	negative regulation of cellular process
GO:0071704	0.317	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.912	protein-containing complex
GO:0005737	0.862	cytoplasm
GO:0070013	0.747	intracellular organelle lumen
GO:0031981	0.711	nuclear lumen
GO:0005654	0.663	nucleoplasm
GO:0005829	0.462	cytosol
GO:1990234	0.396	transferase complex
GO:0140535	0.370	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]