StarFunc result for job id P61964

User Input

>input (334 residues)
MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL
ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKL
WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH
TDVVISTACHPTENIIASAALENDKTIKLWKSDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61964	1.000	1.000	1.195E-63	334	1.000	1.000	P61964.pdb.gz	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
2	AFDB:Q9V3J8	0.917	0.849	1.268E-59	361	0.877	0.812	Q9V3J8.pdb.gz	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
3	PDB:2h9lA	0.919	0.956	4.579E-58	321	0.931	0.969	2h9lA.pdb.gz
4	AFDB:Q4V8C4	0.910	0.927	6.039E-56	328	0.793	0.808	Q4V8C4.pdb.gz	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
5	AFDB:Q17963	0.903	0.803	2.034E-50	376	0.668	0.593	Q17963.pdb.gz	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
6	AFDB:Q54KL5	0.907	0.905	3.194E-50	335	0.677	0.675	Q54KL5.pdb.gz	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
7	AFDB:Q9M2Z2	0.880	0.927	3.067E-46	317	0.602	0.634	Q9M2Z2.pdb.gz	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
8	AFDB:Q23256	0.896	0.599	1.250E-44	501	0.527	0.351	Q23256.pdb.gz	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
9	AFDB:O43017	0.832	0.734	9.040E-34	380	0.374	0.329	O43017.pdb.gz	SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swd3 PE=1 SV=1
10	AFDB:P43033	0.844	0.690	3.712E-29	410	0.299	0.244	P43033.pdb.gz	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
11	PDB:5o9zL	0.847	0.619	4.668E-29	459	0.260	0.190	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
12	AFDB:Q5BLX8	0.858	0.909	5.285E-28	315	0.296	0.314	Q5BLX8.pdb.gz	WDR83_RAT WD repeat domain-containing protein 83 OS=Rattus norvegicus OX=10116 GN=Wdr83 PE=1 SV=1
13	PDB:1vyhC	0.842	0.906	1.215E-26	310	0.302	0.326	1vyhC.pdb.gz
14	PDB:7a5pz	0.831	0.607	6.041E-26	460	0.168	0.122	7a5pz.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
15	PDB:5mzhB	0.733	0.603	1.913E-25	415	0.296	0.239	5mzhB.pdb.gz
16	PDB:5nnzA	0.726	0.724	4.264E-25	335	0.281	0.281	5nnzA.pdb.gz
17	PDB:5mqfF	0.832	0.903	4.967E-24	307	0.296	0.322	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
18	PDB:3dm0A	0.804	0.406	3.686E-23	675	0.251	0.124	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
19	PDB:5jcsq	0.728	0.515	3.876E-23	488	0.278	0.191	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
20	PDB:5yzgW	0.815	0.626	1.926E-22	440	0.251	0.191	5yzgW.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61964	0.0	682	334	1.000	1.000	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
2	P61965	0.0	682	334	1.000	1.000	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
3	Q498M4	0.0	682	334	1.000	1.000	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
4	Q4V8C4	0.0	545	328	0.802	0.817	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
5	Q7ZTX2	0.0	646	334	0.958	0.958	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
6	Q9V3J8	0.0	595	361	0.859	0.795	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
7	Q54KL5	1.76e-168	473	335	0.659	0.657	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
8	Q17963	2.79e-166	469	376	0.665	0.590	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
9	Q9M2Z2	3.41e-145	414	317	0.590	0.621	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
10	Q23256	7.26e-133	389	501	0.536	0.357	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
11	O43017	4.94e-75	237	380	0.320	0.282	SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swd3 PE=1 SV=1
12	V9GZ59	2.58e-62	195	96	0.287	1.000	V9GZ59_HUMAN WD repeat domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=8
13	Q7T394	2.96e-55	187	410	0.308	0.251	LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio OX=7955 GN=pafah1b1a PE=2 SV=3
14	P63004	7.00e-55	186	410	0.302	0.246	LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus OX=10116 GN=Pafah1b1 PE=1 SV=2
15	P63005	7.00e-55	186	410	0.302	0.246	LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus OX=10090 GN=Pafah1b1 PE=1 SV=2
16	P43033	7.08e-55	186	410	0.302	0.246	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
17	P43034	7.39e-55	186	410	0.302	0.246	LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2
18	Q3Y8L7	3.47e-54	185	446	0.305	0.229	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
19	Q803D2	6.85e-54	183	410	0.299	0.244	LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio OX=7955 GN=pafah1b1b PE=2 SV=3
20	Q8N136	3.33e-52	179	415	0.299	0.241	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.2e-24	96.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF03498 CDtoxinA	1.4e+02	13.5	Cytolethal distending toxin A/C domain
3	PF19235 DUF5888	3.2e+02	12.6	Family of unknown function (DUF5888)
4	PF08662 eIF2A	1.9e-08	46.0	Eukaryotic translation initiation factor eIF2A
5	PF16529 Ge1_WD40	0.003	28.2	WD40 region of Ge1, enhancer of mRNA-decapping protein
6	PF07569 Hira	60	14.7	TUP1-like enhancer of split
7	PF20426 NBCH_WD40	1.7e-16	71.6	Neurobeachin beta propeller domain
8	PF08801 Nucleoporin_N	4.2e+02	11.0	Nup133 N terminal like
9	PF11715 Nup160	2.1e-11	55.0	Nucleoporin Nup120/160
10	PF15869 TolB_like	4e+02	11.7	TolB-like 6-blade propeller-like
11	PF08553 VID27	24	15.4	VID27 C-terminal WD40-like domain
12	PF00400 WD40	4.1e-59	206.3	WD domain, G-beta repeat
13	PF17005 WD40_like	0.0051	27.8	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008842146.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008821549.1	0.999	RB binding protein 5, histone lysine methyltransferase complex subunit
2	1026970.XP_008849115.1	0.999	Histone-lysine N-methyltransferase 2A
3	1026970.XP_008851900.1	0.999	Lysine methyltransferase 2D
4	1026970.XP_008822040.1	0.998	SET domain containing 1A
5	1026970.XP_008820114.1	0.997	KAT8 regulatory NSL complex subunit 1
6	1026970.XP_008837636.1	0.997	Histone-lysine N-methyltransferase SETD1B
7	1026970.XP_008845475.1	0.997	Histone-lysine N-methyltransferase 2C
8	1026970.XP_008826300.1	0.996	Histone-lysine N-methyltransferase 2B
9	1026970.XP_008845974.1	0.995	ASH2 like histone lysine methyltransferase complex subunit
10	1026970.XP_008851872.1	0.995	KAT8 regulatory NSL complex subunit 2 isoform X1
11	1026970.XP_008822023.1	0.994	Histone acetyltransferase KAT8
12	1026970.XP_008827791.1	0.993	Host cell factor C1
13	1026970.XP_008845513.1	0.991	PAX-interacting protein 1
14	1026970.XP_008848177.1	0.991	WD repeat-containing protein 82
15	1026970.XP_008848940.1	0.991	CXXC finger protein 1
16	1026970.XP_008828886.1	0.990	YEATS domain containing 2
17	1026970.XP_008837123.1	0.988	Menin isoform X1
18	1026970.XP_008846309.1	0.988	Transcriptional adaptor 2A
19	1026970.XP_008822501.1	0.987	E3 ubiquitin-protein ligase RING2
20	1026970.XP_008833507.1	0.987	Histone acetyltransferase KAT2A isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.986	biological regulation
GO:0050794	0.979	regulation of cellular process
GO:0071704	0.964	organic substance metabolic process
GO:0044238	0.960	primary metabolic process
GO:0019222	0.947	regulation of metabolic process
GO:0032502	0.946	developmental process
GO:0006807	0.946	nitrogen compound metabolic process
GO:0048518	0.940	positive regulation of biological process
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0080090	0.928	regulation of primary metabolic process
GO:0043170	0.927	macromolecule metabolic process
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0032501	0.901	multicellular organismal process
GO:0018205	0.889	peptidyl-lysine modification
GO:0048522	0.885	positive regulation of cellular process
GO:0043543	0.865	protein acylation
GO:0016570	0.857	histone modification
GO:0031056	0.847	regulation of histone modification
GO:0051302	0.834	regulation of cell division
GO:0010468	0.828	regulation of gene expression
GO:0006475	0.827	internal protein amino acid acetylation
GO:0048856	0.815	anatomical structure development
GO:0009893	0.812	positive regulation of metabolic process
GO:0010604	0.802	positive regulation of macromolecule metabolic process
GO:0090311	0.801	regulation of protein deacetylation
GO:0009889	0.793	regulation of biosynthetic process
GO:0019219	0.786	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.785	positive regulation of cellular metabolic process
GO:0007275	0.783	multicellular organism development
GO:0071840	0.771	cellular component organization or biogenesis
GO:0010556	0.770	regulation of macromolecule biosynthetic process
GO:0031326	0.769	regulation of cellular biosynthetic process
GO:0016043	0.754	cellular component organization
GO:0051173	0.746	positive regulation of nitrogen compound metabolic process
GO:0048731	0.743	system development
GO:0006355	0.740	regulation of DNA-templated transcription
GO:0006325	0.733	chromatin organization
GO:0031060	0.667	regulation of histone methylation
GO:0018394	0.658	peptidyl-lysine acetylation
GO:0016573	0.654	histone acetylation
GO:0009892	0.641	negative regulation of metabolic process
GO:0010605	0.621	negative regulation of macromolecule metabolic process
GO:0031058	0.566	positive regulation of histone modification
GO:0031062	0.563	positive regulation of histone methylation
GO:0006338	0.549	chromatin remodeling
GO:0044237	0.534	cellular metabolic process
GO:0006357	0.507	regulation of transcription by RNA polymerase II
GO:0051172	0.481	negative regulation of nitrogen compound metabolic process
GO:0048523	0.437	negative regulation of cellular process
GO:0043967	0.345	histone H4 acetylation
GO:0045935	0.334	positive regulation of nucleobase-containing compound metabolic process
GO:0043966	0.325	histone H3 acetylation
GO:0031063	0.322	regulation of histone deacetylation
GO:0031057	0.316	negative regulation of histone modification
GO:0031324	0.314	negative regulation of cellular metabolic process
GO:0051726	0.304	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0000785	0.986	chromatin
GO:0140535	0.973	intracellular protein-containing complex
GO:1990234	0.955	transferase complex
GO:0000123	0.876	histone acetyltransferase complex
GO:0140672	0.856	ATAC complex
GO:0140513	0.748	nuclear protein-containing complex
GO:0035097	0.391	histone methyltransferase complex
GO:0048188	0.322	Set1C/COMPASS complex
GO:1902562	0.321	H4 histone acetyltransferase complex
GO:0044666	0.315	MLL3/4 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]