StarFunc result for job id P61968

User Input

>input (165 residues)
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDI
GTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRN
RLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61968	1.000	1.000	5.760E-33	165	1.000	1.000	P61968.pdb.gz	LMO4_HUMAN LIM domain transcription factor LMO4 OS=Homo sapiens OX=9606 GN=LMO4 PE=1 SV=1
2	AFDB:Q8AW92	0.818	0.789	8.064E-26	171	0.788	0.760	Q8AW92.pdb.gz	LMO4A_XENLA LIM domain transcription factor LMO4-A OS=Xenopus laevis OX=8355 GN=lmo4-a PE=1 SV=1
3	AFDB:Q8QG63	0.785	0.776	3.236E-23	167	0.739	0.731	Q8QG63.pdb.gz	Q8QG63_DANRE LIM domain only 4 OS=Danio rerio OX=7955 GN=lmo4 PE=1 SV=1
4	AFDB:A9ED84	0.719	0.810	6.259E-18	145	0.424	0.483	A9ED84.pdb.gz	A9ED84_PIG LIM domain only 3 OS=Sus scrofa OX=9823 GN=LMO3 PE=1 SV=1
5	AFDB:A9ED79	0.692	0.729	4.169E-17	156	0.418	0.442	A9ED79.pdb.gz	A9ED79_PIG LIM domain only 1 OS=Sus scrofa OX=9823 GN=LMO1 PE=2 SV=1
6	AFDB:Q8IQX7	0.729	0.327	1.109E-16	384	0.430	0.185	Q8IQX7.pdb.gz	Q8IQX7_DROME Beadex, isoform B OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
7	AFDB:Q9VL21	0.691	0.477	1.506E-16	241	0.467	0.320	Q9VL21.pdb.gz	Q9VL21_DROME LD11652p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5708 PE=1 SV=2
8	AFDB:M9PHX4	0.718	0.324	3.336E-16	383	0.436	0.188	M9PHX4.pdb.gz	M9PHX4_DROME Beadex, isoform F OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=2
9	AFDB:P25791	0.623	0.646	5.785E-16	158	0.376	0.392	P25791.pdb.gz	RBTN2_HUMAN Rhombotin-2 OS=Homo sapiens OX=9606 GN=LMO2 PE=1 SV=1
10	AFDB:Q9PTJ3	0.614	0.634	7.389E-16	159	0.345	0.358	Q9PTJ3.pdb.gz	RBTN2_DANRE Rhombotin-2 OS=Danio rerio OX=7955 GN=lmo2 PE=2 SV=1
11	PDB:4kfzB	0.408	0.450	2.595E-14	148	0.358	0.399	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.333	0.289	5.478E-5	192	0.182	0.156	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.282	0.555	9.925E-3	76	0.079	0.171	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:5dkaA	0.151	0.246	8.630E-1	96	0.079	0.135	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:4wa6D	0.146	0.069	1.037	415	0.055	0.022	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:5cd1B	0.139	0.082	1.798	321	0.030	0.016	5cd1B.pdb.gz	Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
17	PDB:3b4vD	0.108	0.092	1.911	213	0.115	0.089	3b4vD.pdb.gz
18	PDB:7q3nU	0.143	0.100	1.911	292	0.139	0.079	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
19	PDB:2h3pA	0.136	0.054	2.296	599	0.103	0.028	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates
20	PDB:4wvhA	0.133	0.058	2.296	519	0.085	0.027	4wvhA.pdb.gz	Peptide binding to a bacterial signal peptidase visualized by peptide tethering and carrier-driven crystallization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61968	5.05e-122	342	165	1.000	1.000	LMO4_HUMAN LIM domain transcription factor LMO4 OS=Homo sapiens OX=9606 GN=LMO4 PE=1 SV=1
2	P61969	5.05e-122	342	165	1.000	1.000	LMO4_MOUSE LIM domain transcription factor LMO4 OS=Mus musculus OX=10090 GN=Lmo4 PE=1 SV=1
3	Q8AW92	7.92e-97	278	171	0.806	0.778	LMO4A_XENLA LIM domain transcription factor LMO4-A OS=Xenopus laevis OX=8355 GN=lmo4-a PE=1 SV=1
4	Q8QG63	2.16e-92	267	167	0.770	0.760	Q8QG63_DANRE LIM domain only 4 OS=Danio rerio OX=7955 GN=lmo4 PE=1 SV=1
5	A0A2R8RLI6	1.52e-91	265	166	0.764	0.759	A0A2R8RLI6_DANRE LIM domain only 4a OS=Danio rerio OX=7955 GN=NH13 PE=1 SV=1
6	P25800	1.85e-49	158	156	0.442	0.468	RBTN1_HUMAN Rhombotin-1 OS=Homo sapiens OX=9606 GN=LMO1 PE=1 SV=1
7	Q924W9	5.27e-49	157	156	0.442	0.468	RBTN1_MOUSE Rhombotin-1 OS=Mus musculus OX=10090 GN=Lmo1 PE=2 SV=1
8	A9ED79	1.08e-47	154	156	0.430	0.455	A9ED79_PIG LIM domain only 1 OS=Sus scrofa OX=9823 GN=LMO1 PE=2 SV=1
9	A9ED84	3.40e-47	152	145	0.406	0.462	A9ED84_PIG LIM domain only 3 OS=Sus scrofa OX=9823 GN=LMO3 PE=1 SV=1
10	Q8TAP4	3.40e-47	152	145	0.406	0.462	LMO3_HUMAN LIM domain only protein 3 OS=Homo sapiens OX=9606 GN=LMO3 PE=1 SV=1
11	P91608	4.42e-46	153	266	0.412	0.256	P91608_DROSP Dttg protein OS=Drosophila sp. OX=7242 GN=dttg PE=2 SV=1
12	O77284	1.19e-45	153	313	0.412	0.217	O77284_DROME Beadex, isoform A OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
13	M9PHX4	2.00e-45	154	383	0.412	0.178	M9PHX4_DROME Beadex, isoform F OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=2
14	Q8IQX7	3.88e-45	154	384	0.412	0.177	Q8IQX7_DROME Beadex, isoform B OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
15	M9PI02	1.11e-44	153	424	0.412	0.160	M9PI02_DROME Beadex, isoform D OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
16	Q9VL21	1.68e-42	143	241	0.406	0.278	Q9VL21_DROME LD11652p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5708 PE=1 SV=2
17	P25791	5.32e-37	126	158	0.358	0.373	RBTN2_HUMAN Rhombotin-2 OS=Homo sapiens OX=9606 GN=LMO2 PE=1 SV=1
18	P25801	5.67e-37	126	158	0.358	0.373	RBTN2_MOUSE Rhombotin-2 OS=Mus musculus OX=10090 GN=Lmo2 PE=1 SV=1
19	Q9PTJ3	6.37e-37	126	159	0.358	0.371	RBTN2_DANRE Rhombotin-2 OS=Danio rerio OX=7955 GN=lmo2 PE=2 SV=1
20	Q90XH3	8.96e-37	126	158	0.358	0.373	RBTN2_XENLA Rhombotin-2 OS=Xenopus laevis OX=8355 GN=lmo2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20120 DUF6510	43	15.4	Family of unknown function (DUF6510)
2	PF05077 DUF678	8e+02	11.6	Protein of unknown function (DUF678)
3	PF00412 LIM	1.7e-28	109.9	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000000710

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000020906	0.870	LIM domain binding 1
2	9555.ENSPANP00000001276	0.808	Single stranded DNA binding protein 4
3	9555.ENSPANP00000015968	0.808	Single stranded DNA binding protein 3
4	9555.ENSPANP00000018495	0.760	LIM domain binding 2
5	9555.ENSPANP00000008711	0.755	RB binding protein 8, endonuclease
6	9555.ENSPANP00000014724	0.725	Interleukin 6 signal transducer
7	9555.ENSPANP00000019244	0.725	Janus kinase 2
8	9555.ENSPANP00000011255	0.717	annotation not available
9	9555.ENSPANP00000018050	0.717	Single-stranded DNA binding protein 2
10	9555.ENSPANP00000013385	0.714	Metastasis associated 1
11	9555.ENSPANP00000006026	0.707	Janus kinase 1
12	9555.ENSPANP00000004176	0.702	Histone deacetylase 1
13	9555.ENSPANP00000016119	0.702	Growth factor receptor-bound protein 2
14	9555.ENSPANP00000015224	0.699	Estrogen receptor
15	9555.ENSPANP00000008419	0.695	Forkhead box O1
16	9555.ENSPANP00000000072	0.685	Tyrosine kinase 2
17	9555.ENSPANP00000016565	0.685	Belongs to the protein kinase superfamily.
18	9555.ENSPANP00000016865	0.685	HCK proto-oncogene, Src family tyrosine kinase
19	9555.ENSPANP00000010541	0.682	Protein inhibitor of activated STAT, 3
20	9555.ENSPANP00000014172	0.682	Protein inhibitor of activated STAT, 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.745	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0032501	0.992	multicellular organismal process
GO:0010468	0.991	regulation of gene expression
GO:0050794	0.988	regulation of cellular process
GO:0032502	0.986	developmental process
GO:0009987	0.981	cellular process
GO:0048856	0.977	anatomical structure development
GO:0048518	0.966	positive regulation of biological process
GO:0048522	0.957	positive regulation of cellular process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0009893	0.947	positive regulation of metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0031323	0.941	regulation of cellular metabolic process
GO:0009889	0.938	regulation of biosynthetic process
GO:0010604	0.921	positive regulation of macromolecule metabolic process
GO:0010556	0.900	regulation of macromolecule biosynthetic process
GO:0031326	0.899	regulation of cellular biosynthetic process
GO:0051252	0.881	regulation of RNA metabolic process
GO:0006355	0.855	regulation of DNA-templated transcription
GO:0007275	0.852	multicellular organism development
GO:0050896	0.825	response to stimulus
GO:0031325	0.824	positive regulation of cellular metabolic process
GO:0048731	0.804	system development
GO:0051173	0.794	positive regulation of nitrogen compound metabolic process
GO:0009891	0.790	positive regulation of biosynthetic process
GO:0031328	0.729	positive regulation of cellular biosynthetic process
GO:0045944	0.717	positive regulation of transcription by RNA polymerase II
GO:0048513	0.528	animal organ development
GO:0048519	0.511	negative regulation of biological process
GO:0048523	0.475	negative regulation of cellular process
GO:0030154	0.465	cell differentiation
GO:0042221	0.454	response to chemical
GO:0007399	0.394	nervous system development
GO:0051239	0.366	regulation of multicellular organismal process
GO:0071840	0.336	cellular component organization or biogenesis
GO:0050793	0.322	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.978	protein-containing complex
GO:0005667	0.804	transcription regulator complex
GO:0140513	0.502	nuclear protein-containing complex
GO:0005654	0.472	nucleoplasm
GO:0090575	0.364	RNA polymerase II transcription regulator complex
GO:0031252	0.326	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]