StarFunc result for job id P61978

User Input

>input (463 residues)
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61978	0.999	0.999	4.233E-83	463	1.000	1.000	P61978.pdb.gz	HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1
2	AFDB:Q5T6W2	0.407	0.493	1.231E-56	379	0.819	1.000	Q5T6W2.pdb.gz	Q5T6W2_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1
3	AFDB:O82762	0.165	0.122	9.859E-13	632	0.168	0.123	O82762.pdb.gz	O82762_ARATH F17H15.1/F17H15.1 OS=Arabidopsis thaliana OX=3702 GN=At2g25970 PE=1 SV=1
4	AFDB:Q9V4F3	0.142	0.108	2.056E-11	628	0.125	0.092	Q9V4F3.pdb.gz	Q9V4F3_DROME LD09246p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11360 PE=2 SV=2
5	AFDB:Q24009	0.172	0.098	4.109E-7	905	0.112	0.057	Q24009.pdb.gz	BICC_DROME Protein bicaudal C OS=Drosophila melanogaster OX=7227 GN=BicC PE=1 SV=2
6	AFDB:Q99MQ1	0.130	0.065	2.702E-6	977	0.121	0.057	Q99MQ1.pdb.gz	BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus OX=10090 GN=Bicc1 PE=1 SV=1
7	AFDB:O08715	0.155	0.092	4.134E-6	857	0.143	0.077	O08715.pdb.gz	AKAP1_MOUSE A-kinase anchor protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Akap1 PE=1 SV=4
8	AFDB:O75179	0.161	0.032	7.589E-6	2603	0.106	0.019	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
9	AFDB:A0A0A0MQZ8	0.156	0.086	2.265E-5	866	0.134	0.072	A0A0A0MQZ8.pdb.gz	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
10	AFDB:A0A0G2K916	0.153	0.029	2.558E-5	2615	0.099	0.018	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
11	PDB:6ofsA	0.120	0.069	3.750E-3	905	0.065	0.033	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
12	PDB:6ke6RC	0.121	0.186	3.985E-3	278	0.086	0.144	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
13	PDB:7ajuJJ	0.126	0.280	5.081E-3	199	0.050	0.116	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7mqaSW	0.143	0.303	5.081E-3	195	0.054	0.128	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7mq8NY	0.129	0.199	5.738E-3	274	0.060	0.102	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6n7pG	0.194	0.333	8.779E-3	239	0.028	0.054	6n7pG.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
17	PDB:2f1fA	0.113	0.273	9.329E-3	163	0.063	0.178	2f1fA.pdb.gz
18	PDB:6wo1B	0.111	0.227	1.517E-2	197	0.048	0.112	6wo1B.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
19	PDB:6u9hG	0.116	0.245	1.820E-2	169	0.045	0.124	6u9hG.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
20	PDB:6vz8F	0.101	0.231	2.055E-2	159	0.037	0.107	6vz8F.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61978	0.0	940	463	1.000	1.000	HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1
2	P61979	0.0	940	463	1.000	1.000	HNRPK_MOUSE Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus OX=10090 GN=Hnrnpk PE=1 SV=1
3	P61980	0.0	940	463	1.000	1.000	HNRPK_RAT Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus OX=10116 GN=Hnrnpk PE=1 SV=1
4	Q5T6W2	0.0	757	379	0.819	1.000	Q5T6W2_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1
5	Q61990	6.41e-40	149	362	0.259	0.331	PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus OX=10090 GN=Pcbp2 PE=1 SV=1
6	Q6AYU2	6.41e-40	149	362	0.259	0.331	Q6AYU2_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=4 SV=1
7	Q15366	8.48e-40	149	365	0.257	0.326	PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1
8	Q6AYU5	8.48e-40	149	365	0.257	0.326	Q6AYU5_RAT Poly(RC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
9	A0A384N6B9	1.13e-39	148	366	0.259	0.328	A0A384N6B9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
10	Q7KHL0	1.45e-37	145	508	0.186	0.169	Q7KHL0_DROME Bancal protein OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=2 SV=1
11	Q9V948	1.76e-37	145	490	0.186	0.176	Q9V948_DROME HnRNP K protein homolog OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=2 SV=3
12	Q7KA80	1.85e-37	145	496	0.184	0.171	Q7KA80_DROME Heterogeneous nuclear ribonucleoprotein (HnRNP) OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=2 SV=1
13	E1JGN7	2.00e-37	145	493	0.186	0.174	E1JGN7_DROME Heterogeneous nuclear ribonucleoprotein K, isoform E OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=1 SV=1
14	A1ZBW0	2.25e-37	145	502	0.192	0.177	A1ZBW0_DROME Heterogeneous nuclear ribonucleoprotein K, isoform C OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=1 SV=1
15	A1ZBW1	2.40e-37	144	496	0.186	0.173	A1ZBW1_DROME Heterogeneous nuclear ribonucleoprotein K, isoform A OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=1 SV=1
16	P60335	1.05e-35	137	356	0.259	0.337	PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus OX=10090 GN=Pcbp1 PE=1 SV=1
17	Q15365	1.05e-35	137	356	0.259	0.337	PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2
18	Q53SS8	1.05e-35	137	356	0.259	0.337	Q53SS8_HUMAN Epididymis secretory protein Li 85 OS=Homo sapiens OX=9606 GN=PCBP1 PE=2 SV=1
19	A0A8I6AGT9	4.17e-32	127	349	0.248	0.330	A0A8I6AGT9_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=4 SV=1
20	A0A8I6APK5	9.92e-24	102	274	0.127	0.215	A0A8I6APK5_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01965 DJ-1_PfpI	1.3e+02	13.7	DJ-1/PfpI family
2	PF05334 DUF719	2.2e+02	13.3	Protein of unknown function (DUF719)
3	PF00013 KH_1	3.8e-40	146.9	KH domain
4	PF07650 KH_2	7.2e-11	53.1	KH domain
5	PF13083 KH_4	1.1e-05	36.6	KH domain
6	PF13184 KH_5	1.2	20.7	NusA-like KH domain
7	PF16005 MOEP19	11	17.3	KH-like RNA-binding domain
8	PF08067 ROKNT	9.1e-20	82.0	ROKNT (NUC014) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10090.ENSMUSP00000039269

Rank	PPI partner	STRING score	Description
1	10090.ENSMUSP00000110103	0.996	Heterogeneous nuclear ribonucleoproteins A2/B1
2	10090.ENSMUSP00000120115	0.996	Heterogeneous nuclear ribonucleoprotein M
3	10090.ENSMUSP00000126192	0.996	Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre- mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre- mRNA. Represses the splicing of MAPT/Tau exon 10
4	10090.ENSMUSP00000107237	0.995	Heterogeneous nuclear ribonucleoproteins C1/C2
5	10090.ENSMUSP00000130023	0.995	Heterogeneous nuclear ribonucleoprotein F
6	10090.ENSMUSP00000134734	0.991	Heterogeneous nuclear ribonucleoprotein L
7	10090.ENSMUSP00000047571	0.990	Heterogeneous nuclear ribonucleoprotein U
8	10090.ENSMUSP00000076989	0.989	Heterogeneous nuclear ribonucleoprotein H
9	10090.ENSMUSP00000021062	0.983	Involved in the alternative regulation of pre-mRNA splicing
10	10090.ENSMUSP00000107595	0.983	Heterogeneous nuclear ribonucleoprotein A3
11	10090.ENSMUSP00000138399	0.981	Heterogeneous nuclear ribonucleoprotein R
12	10090.ENSMUSP00000007980	0.980	Heterogeneous nuclear ribonucleoprotein A0
13	10090.ENSMUSP00000042658	0.980	Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May bind to specific miRNA hairpins. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1
14	10090.ENSMUSP00000120595	0.980	Serine/arginine-rich splicing factor 1
15	10090.ENSMUSP00000108828	0.978	Heterogeneous nuclear ribonucleoprotein H2
16	10090.ENSMUSP00000096549	0.971	ELAV-like protein 1
17	10090.ENSMUSP00000066516	0.968	KH domain-containing, RNA-binding, signal transduction-associated protein 1
18	10090.ENSMUSP00000132735	0.962	Heterogeneous nuclear ribonucleoprotein D0
19	10090.ENSMUSP00000054863	0.959	Poly(rC)-binding protein 1
20	10090.ENSMUSP00000063744	0.941	Heterogeneous nuclear ribonucleoprotein Q

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0019904	0.886	protein domain specific binding
GO:0003729	0.860	mRNA binding
GO:0045296	0.854	cadherin binding
GO:0042802	0.791	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0019222	0.994	regulation of metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0048518	0.966	positive regulation of biological process
GO:0031326	0.966	regulation of cellular biosynthetic process
GO:0010468	0.965	regulation of gene expression
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0009987	0.964	cellular process
GO:0048519	0.960	negative regulation of biological process
GO:0051252	0.923	regulation of RNA metabolic process
GO:0048523	0.913	negative regulation of cellular process
GO:0048522	0.908	positive regulation of cellular process
GO:0009892	0.886	negative regulation of metabolic process
GO:0006355	0.865	regulation of DNA-templated transcription
GO:0010605	0.847	negative regulation of macromolecule metabolic process
GO:0051172	0.841	negative regulation of nitrogen compound metabolic process
GO:0031324	0.829	negative regulation of cellular metabolic process
GO:0010941	0.730	regulation of cell death
GO:0051253	0.716	negative regulation of RNA metabolic process
GO:0050896	0.707	response to stimulus
GO:0071704	0.628	organic substance metabolic process
GO:0044238	0.612	primary metabolic process
GO:0043170	0.603	macromolecule metabolic process
GO:0006807	0.586	nitrogen compound metabolic process
GO:0044237	0.572	cellular metabolic process
GO:0051716	0.531	cellular response to stimulus
GO:0009893	0.453	positive regulation of metabolic process
GO:0043484	0.438	regulation of RNA splicing
GO:0010604	0.435	positive regulation of macromolecule metabolic process
GO:0034641	0.432	cellular nitrogen compound metabolic process
GO:0043067	0.406	regulation of programmed cell death
GO:0006357	0.385	regulation of transcription by RNA polymerase II
GO:0010558	0.373	negative regulation of macromolecule biosynthetic process
GO:0031327	0.372	negative regulation of cellular biosynthetic process
GO:0051173	0.370	positive regulation of nitrogen compound metabolic process
GO:0031325	0.370	positive regulation of cellular metabolic process
GO:0032502	0.361	developmental process
GO:0042981	0.359	regulation of apoptotic process
GO:0010467	0.338	gene expression
GO:0048856	0.324	anatomical structure development
GO:0045892	0.324	negative regulation of DNA-templated transcription
GO:0090304	0.316	nucleic acid metabolic process
GO:0032501	0.303	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005737	0.997	cytoplasm
GO:0005634	0.992	nucleus
GO:0043228	0.986	non-membrane-bounded organelle
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0005654	0.862	nucleoplasm
GO:0032991	0.773	protein-containing complex
GO:0030054	0.711	cell junction
GO:0016020	0.605	membrane
GO:0005694	0.389	chromosome
GO:0000785	0.384	chromatin
GO:0071013	0.357	catalytic step 2 spliceosome
GO:0005925	0.354	focal adhesion
GO:0070062	0.347	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]