StarFunc result for job id P62072

User Input

>input (90 residues)
MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLD
IHERMGKKLTELSMQDEELMKRVQQSSGPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62072	1.000	1.000	1.650E-13	90	1.000	1.000	P62072.pdb.gz	TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1
2	PDB:2bskD	0.763	0.763	1.345E-11	90	1.000	1.000	2bskD.pdb.gz
3	AFDB:Q9W2D6	0.891	0.872	4.336E-9	92	0.600	0.587	Q9W2D6.pdb.gz	TIM10_DROME Mitochondrial import inner membrane translocase subunit Tim10 OS=Drosophila melanogaster OX=7227 GN=Tim10 PE=3 SV=1
4	AFDB:Q9Y0V6	0.869	0.908	3.415E-8	86	0.522	0.547	Q9Y0V6.pdb.gz	TIM10_CAEEL Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis elegans OX=6239 GN=tin-10 PE=3 SV=1
5	AFDB:P87108	0.800	0.776	2.218E-5	93	0.289	0.280	P87108.pdb.gz	TIM10_YEAST Mitochondrial import inner membrane translocase subunit TIM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM10 PE=1 SV=1
6	PDB:6lo8H	0.712	0.859	2.296E-4	74	0.289	0.351	6lo8H.pdb.gz
7	AFDB:P32830	0.760	0.630	3.559E-4	109	0.244	0.202	P32830.pdb.gz	TIM12_YEAST Mitochondrial import inner membrane translocase subunit TIM12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM12 PE=1 SV=1
8	AFDB:Q9XGY4	0.672	0.779	1.193E-3	77	0.289	0.338	Q9XGY4.pdb.gz	TIM8_ARATH Mitochondrial import inner membrane translocase subunit TIM8 OS=Arabidopsis thaliana OX=3702 GN=TIM8 PE=1 SV=1
9	PDB:6lo8F	0.710	0.759	1.684E-3	84	0.222	0.238	6lo8F.pdb.gz
10	AFDB:O74700	0.829	0.857	2.264E-3	87	0.189	0.195	O74700.pdb.gz	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1
11	AFDB:Q57XQ4	0.769	0.880	2.431E-3	78	0.189	0.218	Q57XQ4.pdb.gz	Q57XQ4_TRYB2 Mitochondrial import inner membrane translocase subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.130 PE=3 SV=1
12	AFDB:A0A024R648	0.769	0.777	3.470E-3	89	0.222	0.225	A0A024R648.pdb.gz
13	PDB:2bskC	0.695	0.782	4.248E-3	79	0.200	0.228	2bskC.pdb.gz
14	AFDB:Q9Y5J6	0.718	0.636	4.613E-3	103	0.256	0.223	Q9Y5J6.pdb.gz	T10B_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1
15	PDB:6lo8E	0.707	0.788	8.060E-3	80	0.167	0.188	6lo8E.pdb.gz
16	PDB:7cgpJ	0.666	0.715	4.142E-2	83	0.222	0.241	7cgpJ.pdb.gz
17	PDB:7lbmo	0.395	0.344	1.561	108	0.189	0.157	7lbmo.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
18	PDB:5i08A	0.261	0.044	1.676	958	0.067	0.006	5i08A.pdb.gz
19	PDB:6tqnX	0.312	0.035	3.415	1342	0.122	0.008	6tqnX.pdb.gz	Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
20	PDB:6c0fw	0.498	0.621	3.938	70	0.056	0.071	6c0fw.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62072	2.05e-62	185	90	1.000	1.000	TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1
2	P62073	2.05e-62	185	90	1.000	1.000	TIM10_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 OS=Mus musculus OX=10090 GN=Timm10 PE=1 SV=1
3	Q9W2D6	4.21e-39	127	92	0.600	0.587	TIM10_DROME Mitochondrial import inner membrane translocase subunit Tim10 OS=Drosophila melanogaster OX=7227 GN=Tim10 PE=3 SV=1
4	Q9Y0V6	1.29e-31	107	86	0.489	0.512	TIM10_CAEEL Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis elegans OX=6239 GN=tin-10 PE=3 SV=1
5	P87108	1.30e-17	72.4	93	0.289	0.280	TIM10_YEAST Mitochondrial import inner membrane translocase subunit TIM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM10 PE=1 SV=1
6	F4IKQ3	5.27e-10	53.5	107	0.244	0.206	F4IKQ3_ARATH Mitochondrial import inner membrane translocase subunit OS=Arabidopsis thaliana OX=3702 GN=TIM10 PE=1 SV=1
7	P32830	3.74e-07	46.2	109	0.211	0.174	TIM12_YEAST Mitochondrial import inner membrane translocase subunit TIM12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM12 PE=1 SV=1
8	Q9Y0V3	2.05e-04	39.3	117	0.178	0.137	T10B_DROME Mitochondrial import inner membrane translocase subunit Tim10B OS=Drosophila melanogaster OX=7227 GN=Tim9b PE=3 SV=1
9	Q9Y5J7	5.60e-04	37.7	89	0.189	0.191	TIM9_HUMAN Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1
10	O74700	0.002	35.8	87	0.233	0.241	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1
11	P57744	0.002	36.2	87	0.178	0.184	TIM8_YEAST Mitochondrial import inner membrane translocase subunit TIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM8 PE=1 SV=1
12	Q9WV98	0.002	36.2	89	0.189	0.191	TIM9_MOUSE Mitochondrial import inner membrane translocase subunit Tim9 OS=Mus musculus OX=10090 GN=Timm9 PE=1 SV=1
13	Q9XGX9	0.002	36.2	93	0.200	0.194	TIM9_ARATH Mitochondrial import inner membrane translocase subunit TIM9 OS=Arabidopsis thaliana OX=3702 GN=TIM9 PE=1 SV=2
14	Q9Y5J6	0.004	35.4	103	0.200	0.175	T10B_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1
15	Q9WV96	0.007	34.7	100	0.200	0.180	T10B_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 B OS=Mus musculus OX=10090 GN=Timm10b PE=1 SV=1
16	P53299	0.008	35.0	105	0.167	0.143	TIM13_YEAST Mitochondrial import inner membrane translocase subunit TIM13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM13 PE=1 SV=1
17	Q6FRT3	0.008	34.7	87	0.244	0.253	TIM9_CANGA Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TIM9 PE=3 SV=1
18	Q9Y5L4	0.023	33.5	95	0.200	0.189	TIM13_HUMAN Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1
19	Q9XGY4	0.024	33.1	77	0.256	0.299	TIM8_ARATH Mitochondrial import inner membrane translocase subunit TIM8 OS=Arabidopsis thaliana OX=3702 GN=TIM8 PE=1 SV=1
20	P62075	0.077	32.0	95	0.167	0.158	TIM13_MOUSE Mitochondrial import inner membrane translocase subunit Tim13 OS=Mus musculus OX=10090 GN=Timm13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02953 zf-Tim10_DDP	2.3e-20	83.3	Tim10/DDP family zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008834368.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008835315.1	0.999	Mitochondrial import inner membrane translocase subunit Tim13
2	1026970.XP_008837733.1	0.999	Mitochondrial import inner membrane translocase subunit Tim9
3	1026970.XP_008835614.1	0.996	Translocase of inner mitochondrial membrane 10B
4	1026970.XP_008826970.1	0.990	Translocase of inner mitochondrial membrane 22
5	1026970.XP_008821837.1	0.970	Putative mitochondrial import inner membrane translocase subunit Tim8 A-B
6	1026970.XP_008846550.1	0.970	Mitochondrial import inner membrane translocase subunit Tim8 A
7	1026970.XP_008831005.1	0.953	Translocase of inner mitochondrial membrane 8 homolog B
8	1026970.XP_008853164.1	0.947	Coiled-coil-helix-coiled-coil-helix domain containing 4
9	1026970.XP_008851277.1	0.915	Solute carrier family 25 member 6
10	1026970.XP_008828529.1	0.908	Mitochondrial import inner membrane translocase subunit Tim17-A
11	1026970.XP_008840783.1	0.883	Mitochondrial import inner membrane translocase subunit Tim17-B
12	1026970.XP_008848886.1	0.876	Translocase of inner mitochondrial membrane 21
13	1026970.XP_008831006.1	0.863	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
14	1026970.XP_008852035.1	0.856	grpE protein homolog 1, mitochondrial
15	1026970.XP_008832254.1	0.854	Translocase of inner mitochondrial membrane 23
16	1026970.XP_008832331.1	0.854	Putative mitochondrial import inner membrane translocase subunit Tim23B
17	1026970.XP_008854455.1	0.852	Growth factor, augmenter of liver regeneration
18	1026970.XP_008852187.1	0.846	Translocase of inner mitochondrial membrane 50
19	1026970.XP_008831768.1	0.837	Translocase of inner mitochondrial membrane 29
20	1026970.XP_008843790.1	0.823	Mitochondrial ribosomal protein L43

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	1.000	chaperone binding
GO:0032977	1.000	membrane insertase activity
GO:0042803	1.000	protein homodimerization activity
GO:0008270	1.000	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0051204	0.992	protein insertion into mitochondrial membrane
GO:0006605	0.991	protein targeting
GO:0007007	0.979	inner mitochondrial membrane organization
GO:0006626	0.973	protein targeting to mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005758	1.000	mitochondrial intermembrane space
GO:0098798	0.999	mitochondrial protein-containing complex
GO:1990351	0.997	transporter complex
GO:0016020	0.975	membrane
GO:0031090	0.916	organelle membrane
GO:0031966	0.887	mitochondrial membrane
GO:0005743	0.879	mitochondrial inner membrane
GO:0098796	0.703	membrane protein complex
GO:0098800	0.669	inner mitochondrial membrane protein complex
GO:0042719	0.564	mitochondrial intermembrane space protein transporter complex
GO:0042721	0.353	TIM22 mitochondrial import inner membrane insertion complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]