StarFunc result for job id P62136

User Input

>input (330 residues)
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJS9	0.911	0.882	9.542E-64	341	1.000	0.968	A0A140VJS9.pdb.gz	A0A140VJS9_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P48727	0.955	0.946	1.227E-62	333	0.897	0.889	P48727.pdb.gz	GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans OX=6239 GN=gsp-2 PE=1 SV=1
3	AFDB:Q7ZVR3	0.959	0.953	1.251E-61	332	0.897	0.892	Q7ZVR3.pdb.gz	Q7ZVR3_DANRE Serine/threonine-protein phosphatase OS=Danio rerio OX=7955 GN=zgc:76940 PE=1 SV=1
4	AFDB:P13681	0.922	0.930	5.447E-60	327	0.806	0.813	P13681.pdb.gz	PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis2 PE=1 SV=1
5	AFDB:Q27497	0.916	0.919	1.301E-59	329	0.833	0.836	Q27497.pdb.gz	GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans OX=6239 GN=gsp-1 PE=1 SV=2
6	AFDB:F1QI59	0.918	0.926	1.379E-59	327	0.864	0.872	F1QI59.pdb.gz
7	AFDB:P48461	0.928	0.937	1.739E-59	327	0.876	0.884	P48461.pdb.gz	PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1alpha-96A PE=1 SV=1
8	AFDB:Q59N42	0.915	0.915	3.108E-59	330	0.803	0.803	Q59N42.pdb.gz	Q59N42_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GLC7 PE=3 SV=1
9	AFDB:P20654	0.919	0.939	3.772E-58	323	0.833	0.851	P20654.pdb.gz	PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimG PE=2 SV=1
10	AFDB:P48462	0.933	0.933	1.137E-57	330	0.824	0.824	P48462.pdb.gz	PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster OX=7227 GN=flw PE=1 SV=1
11	PDB:6zejI	0.886	0.833	3.971E-57	351	0.885	0.832	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
12	PDB:1s70A	0.897	0.958	5.412E-56	309	0.855	0.913	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
13	PDB:2nppC	0.846	0.906	8.305E-37	308	0.427	0.458	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
14	PDB:7obeA	0.839	0.583	1.028E-31	480	0.342	0.235	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
15	PDB:1wao1	0.834	0.589	4.389E-31	471	0.336	0.236	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
16	PDB:4il1A	0.810	0.511	4.389E-31	529	0.324	0.202	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
17	PDB:4or9A	0.824	0.685	4.651E-31	399	0.327	0.271	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
18	PDB:1g5bB	0.453	0.645	4.403E-7	221	0.139	0.208	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:5vjvA	0.414	0.452	4.320E-5	298	0.136	0.151	5vjvA.pdb.gz	Structural basis for the preference of the Arabidopsis thalianaphosphatase RLPH2 for tyrosine-phosphorylated substrates.
20	PDB:4dsyB	0.337	0.279	4.156E-4	426	0.112	0.087	4dsyB.pdb.gz	Identification of purple acid phosphatase inhibitors by fragment-based screening: promising new leads for osteoporosis therapeutics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VJS9	674	341	1.000	0.968	A0A140VJS9_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 PE=2 SV=1
2	E9PMD7	590	295	0.894	1.000	E9PMD7_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=2
3	P12982	584	302	0.842	0.921	PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1-87B PE=1 SV=1
4	P13681	561	327	0.812	0.820	PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis2 PE=1 SV=1
5	P20654	573	323	0.836	0.854	PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimG PE=2 SV=1
6	P23880	520	322	0.715	0.733	PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds21 PE=3 SV=1
7	P32598	549	312	0.779	0.824	PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC7 PE=1 SV=1
8	P36873	615	323	0.912	0.932	PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC PE=1 SV=1
9	P36874	617	323	0.912	0.932	PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis OX=8355 GN=ppp1cc-a PE=1 SV=2
10	P48461	598	327	0.870	0.878	PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1alpha-96A PE=1 SV=1
11	P48462	571	330	0.821	0.821	PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster OX=7227 GN=flw PE=1 SV=1
12	P48484	504	321	0.709	0.729	PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana OX=3702 GN=TOPP4 PE=1 SV=1
13	P48486	508	322	0.721	0.739	PP16_ARATH Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana OX=3702 GN=TOPP6 PE=1 SV=2
14	P48727	617	333	0.897	0.889	GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans OX=6239 GN=gsp-2 PE=1 SV=1
15	P62136	682	330	1.000	1.000	PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1
16	P62137	681	330	0.997	0.997	PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus OX=10090 GN=Ppp1ca PE=1 SV=1
17	P62138	682	330	1.000	1.000	PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1ca PE=1 SV=1
18	P62139	682	330	1.000	1.000	PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CA PE=1 SV=1
19	P62140	601	327	0.888	0.896	PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CB PE=1 SV=3
20	P62141	601	327	0.888	0.896	PP1B_MOUSE Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus OX=10090 GN=Ppp1cb PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00149 Metallophos	4.6e-37	140.1	Calcineurin-like phosphoesterase
2	PF16891 STPPase_N	4.3e-19	80.0	Serine-threonine protein phosphatase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008821105.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008826632.1	0.998	Protein phosphatase 1 catalytic subunit beta
2	1026970.XP_008837623.1	0.998	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit isoform X1
3	1026970.XP_008848177.1	0.995	WD repeat-containing protein 82
4	1026970.XP_008836555.1	0.994	Protein phosphatase 1 regulatory subunit 9B
5	1026970.XP_008837860.1	0.993	Protein phosphatase 1 regulatory subunit 3B
6	1026970.XP_008850325.1	0.991	Protein phosphatase 1 regulatory subunit 12A
7	1026970.XP_008839444.1	0.986	Serine/threonine-protein phosphatase 1 regulatory subunit 10
8	1026970.XP_008850823.1	0.986	SSU72 homolog, RNA polymerase II CTD phosphatase
9	1026970.XP_008843234.1	0.982	Protein phosphatase 1 regulatory subunit 15A
10	1026970.XP_008844034.1	0.982	SHOC2, leucine rich repeat scaffold protein
11	1026970.XP_008821963.1	0.979	Apoptosis-stimulating of p53 protein 2
12	1026970.XP_008843528.1	0.979	Protein phosphatase 1 regulatory inhibitor subunit 1B
13	1026970.XP_008830925.1	0.973	TOX high mobility group box family member 4 isoform X1
14	1026970.XP_008827369.1	0.972	Protein phosphatase 1 regulatory subunit 7
15	1026970.XP_008828608.1	0.971	Protein phosphatase 1 regulatory subunit 15B
16	1026970.XP_008820219.1	0.970	WD repeat domain 33
17	1026970.XP_008824383.1	0.970	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
18	1026970.XP_008829190.1	0.970	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
19	1026970.XP_008832053.1	0.967	Protein phosphatase 3 regulatory subunit B, alpha
20	1026970.XP_008847822.1	0.963	Protein phosphatase 1 regulatory subunit 3C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.978	biological regulation
GO:0071704	0.965	organic substance metabolic process
GO:0050789	0.962	regulation of biological process
GO:0016311	0.956	dephosphorylation
GO:0044238	0.954	primary metabolic process
GO:0043170	0.954	macromolecule metabolic process
GO:0006807	0.944	nitrogen compound metabolic process
GO:0050794	0.934	regulation of cellular process
GO:1901564	0.923	organonitrogen compound metabolic process
GO:0043412	0.865	macromolecule modification
GO:0019538	0.780	protein metabolic process
GO:0036211	0.750	protein modification process
GO:0050896	0.705	response to stimulus
GO:0006470	0.600	protein dephosphorylation
GO:0048518	0.512	positive regulation of biological process
GO:0032502	0.470	developmental process
GO:0032501	0.420	multicellular organismal process
GO:0019222	0.413	regulation of metabolic process
GO:0048522	0.398	positive regulation of cellular process
GO:0051716	0.356	cellular response to stimulus
GO:0060255	0.355	regulation of macromolecule metabolic process
GO:0048856	0.349	anatomical structure development
GO:0031323	0.312	regulation of cellular metabolic process
GO:0080090	0.302	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.992	nucleus
GO:0071944	0.989	cell periphery
GO:0016020	0.987	membrane
GO:0005886	0.978	plasma membrane
GO:0032991	0.973	protein-containing complex
GO:0005829	0.919	cytosol
GO:0043228	0.856	non-membrane-bounded organelle
GO:0031974	0.723	membrane-enclosed lumen
GO:0005654	0.670	nucleoplasm
GO:0043232	0.600	intracellular non-membrane-bounded organelle
GO:1902494	0.434	catalytic complex
GO:0030054	0.386	cell junction
GO:1903293	0.377	phosphatase complex
GO:0008287	0.368	protein serine/threonine phosphatase complex
GO:0042995	0.315	cell projection
GO:0120025	0.314	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]