StarFunc result for job id P62140

User Input

>input (327 residues)
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QI59	0.978	0.978	1.821E-67	327	0.976	0.976	F1QI59.pdb.gz
2	AFDB:Q27497	0.919	0.913	2.810E-65	329	0.902	0.897	Q27497.pdb.gz	GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans OX=6239 GN=gsp-1 PE=1 SV=2
3	AFDB:P48727	0.945	0.928	7.170E-64	333	0.862	0.847	P48727.pdb.gz	GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans OX=6239 GN=gsp-2 PE=1 SV=1
4	AFDB:A0A140VJS9	0.910	0.873	1.004E-62	341	0.893	0.856	A0A140VJS9.pdb.gz	A0A140VJS9_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:P13681	0.957	0.957	2.325E-62	327	0.807	0.807	P13681.pdb.gz	PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis2 PE=1 SV=1
6	AFDB:P48462	0.940	0.932	4.499E-62	330	0.890	0.882	P48462.pdb.gz	PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster OX=7227 GN=flw PE=1 SV=1
7	AFDB:Q7ZVR3	0.937	0.923	8.196E-62	332	0.862	0.849	Q7ZVR3.pdb.gz	Q7ZVR3_DANRE Serine/threonine-protein phosphatase OS=Danio rerio OX=7955 GN=zgc:76940 PE=1 SV=1
8	AFDB:Q59N42	0.914	0.905	9.241E-62	330	0.798	0.791	Q59N42.pdb.gz	Q59N42_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GLC7 PE=3 SV=1
9	AFDB:P48461	0.955	0.955	1.324E-61	327	0.841	0.841	P48461.pdb.gz	PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1alpha-96A PE=1 SV=1
10	AFDB:P20654	0.961	0.973	1.586E-61	323	0.832	0.842	P20654.pdb.gz	PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimG PE=2 SV=1
11	PDB:1s70A	0.905	0.958	3.369E-60	309	0.942	0.997	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
12	PDB:6zejI	0.894	0.833	4.243E-57	351	0.835	0.778	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
13	PDB:2nppC	0.852	0.903	4.696E-38	308	0.416	0.442	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
14	PDB:7obeA	0.837	0.576	1.093E-32	480	0.333	0.227	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
15	PDB:1wao1	0.844	0.592	2.383E-32	471	0.336	0.234	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
16	PDB:4il1A	0.830	0.521	2.853E-32	529	0.333	0.206	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
17	PDB:4or9A	0.836	0.689	7.910E-32	399	0.333	0.273	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
18	PDB:1g5bB	0.453	0.640	7.347E-8	221	0.138	0.204	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:5vjvA	0.389	0.421	2.960E-5	298	0.141	0.154	5vjvA.pdb.gz	Structural basis for the preference of the Arabidopsis thalianaphosphatase RLPH2 for tyrosine-phosphorylated substrates.
20	PDB:3ib7A	0.337	0.364	1.249E-4	295	0.122	0.136	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VJS9	593	341	0.896	0.859	A0A140VJS9_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 PE=2 SV=1
2	E9PMD7	510	295	0.792	0.878	E9PMD7_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=2
3	P12982	564	302	0.807	0.874	PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1-87B PE=1 SV=1
4	P13681	566	327	0.807	0.807	PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis2 PE=1 SV=1
5	P20654	587	323	0.832	0.842	PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimG PE=2 SV=1
6	P23880	528	322	0.725	0.736	PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds21 PE=3 SV=1
7	P30366	504	318	0.713	0.733	PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=TOPP1 PE=1 SV=1
8	P32598	539	312	0.768	0.804	PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC7 PE=1 SV=1
9	P36873	590	323	0.872	0.882	PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC PE=1 SV=1
10	P36874	591	323	0.872	0.882	PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis OX=8355 GN=ppp1cc-a PE=1 SV=2
11	P48461	580	327	0.841	0.841	PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1alpha-96A PE=1 SV=1
12	P48462	616	330	0.890	0.882	PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster OX=7227 GN=flw PE=1 SV=1
13	P48482	504	312	0.716	0.750	PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana OX=3702 GN=TOPP2 PE=1 SV=1
14	P48483	508	322	0.713	0.724	PP13_ARATH Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana OX=3702 GN=TOPP3 PE=1 SV=1
15	P48484	514	321	0.725	0.738	PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana OX=3702 GN=TOPP4 PE=1 SV=1
16	P48727	592	333	0.859	0.844	GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans OX=6239 GN=gsp-2 PE=1 SV=1
17	P62136	601	330	0.896	0.888	PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1
18	P62137	600	330	0.893	0.885	PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus OX=10090 GN=Ppp1ca PE=1 SV=1
19	P62138	601	330	0.896	0.888	PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1ca PE=1 SV=1
20	P62139	601	330	0.896	0.888	PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00149 Metallophos	4.3e-36	136.9	Calcineurin-like phosphoesterase
2	PF16891 STPPase_N	2.3e-16	71.2	Serine-threonine protein phosphatase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9986.ENSOCUP00000000885

Rank	PPI partner	STRING score	Description
1	9986.ENSOCUP00000014361	0.999	Protein phosphatase 1, regulatory subunit 12A
2	9986.ENSOCUP00000002815	0.986	Protein phosphatase 1, regulatory subunit 12B
3	9986.ENSOCUP00000008007	0.983	Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase co [...]
4	9986.ENSOCUP00000007400	0.968	WD repeat domain 82
5	9986.ENSOCUP00000019906	0.967	Protein phosphatase 1, regulatory subunit 7
6	9986.ENSOCUP00000016200	0.958	SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae)
7	9986.ENSOCUP00000012136	0.957	Protein phosphatase inhibitor 2
8	9986.ENSOCUP00000020918	0.950	Protein phosphatase 1, regulatory subunit 3B
9	9986.ENSOCUP00000012929	0.948	Protein phosphatase 1, regulatory subunit 3C
10	9986.ENSOCUP00000012567	0.943	Myosin, light chain 12B, regulatory
11	9986.ENSOCUP00000013439	0.940	Protein phosphatase 1, regulatory (inhibitor) subunit 11
12	9986.ENSOCUP00000009792	0.938	WD repeat domain 33
13	9986.ENSOCUP00000000266	0.936	Protein phosphatase 1 regulatory subunit 3A
14	9986.ENSOCUP00000000554	0.936	Uncharacterized protein
15	9986.ENSOCUP00000004197	0.931	Protein kinase which is a key regulator of actin cytoskeleton and cell polarity (By similarity). Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1 and PPP1R12A (By similarity) . Phosphorylates FHOD1 and acts synergistically with it to promote SRC- dependent non-apoptotic plasma membrane blebbing. Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress (By sim [...]
16	9986.ENSOCUP00000024093	0.930	Oryctolagus cuniculus protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), mRNA
17	9986.ENSOCUP00000003994	0.926	Tumor protein p53 binding protein 2
18	9986.ENSOCUP00000014109	0.921	RB transcriptional corepressor 1
19	9986.ENSOCUP00000011861	0.918	Calcium-independent, phospholipid- and diacylglycerol (DAG)- dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin- dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblast [...]
20	9986.ENSOCUP00000003230	0.916	Cleavage and polyadenylation specific factor 3, 73kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.956	cellular process
GO:0050789	0.952	regulation of biological process
GO:0050794	0.884	regulation of cellular process
GO:0071704	0.845	organic substance metabolic process
GO:0044238	0.830	primary metabolic process
GO:0044237	0.812	cellular metabolic process
GO:0043170	0.730	macromolecule metabolic process
GO:0006470	0.716	protein dephosphorylation
GO:0019222	0.302	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0032991	0.981	protein-containing complex
GO:0016020	0.964	membrane
GO:0043227	0.959	membrane-bounded organelle
GO:0043228	0.955	non-membrane-bounded organelle
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005634	0.925	nucleus
GO:0071944	0.871	cell periphery
GO:0043232	0.867	intracellular non-membrane-bounded organelle
GO:0005829	0.866	cytosol
GO:0005886	0.772	plasma membrane
GO:1902494	0.702	catalytic complex
GO:0031974	0.661	membrane-enclosed lumen
GO:0070013	0.586	intracellular organelle lumen
GO:0031981	0.584	nuclear lumen
GO:0005654	0.533	nucleoplasm
GO:0008287	0.359	protein serine/threonine phosphatase complex
GO:0000164	0.330	protein phosphatase type 1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]