StarFunc result for job id P62191

User Input

>input (440 residues)
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62191	1.000	1.000	1.576E-86	440	1.000	1.000	P62191.pdb.gz	PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
2	AFDB:O16368	0.786	0.781	5.750E-73	443	0.836	0.831	O16368.pdb.gz	PRS4_CAEEL Probable 26S proteasome regulatory subunit 4 OS=Caenorhabditis elegans OX=6239 GN=rpt-2 PE=3 SV=1
3	AFDB:Q9SL67	0.784	0.779	1.360E-68	443	0.777	0.772	Q9SL67.pdb.gz	PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT2B PE=1 SV=1
4	AFDB:Q55BV5	0.778	0.780	9.935E-67	439	0.714	0.715	Q55BV5.pdb.gz	PRS4_DICDI 26S proteasome regulatory subunit 4 homolog OS=Dictyostelium discoideum OX=44689 GN=psmC1 PE=1 SV=1
5	AFDB:P36612	0.783	0.769	2.031E-66	448	0.739	0.725	P36612.pdb.gz	PRS4_SCHPO 26S proteasome regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mts2 PE=2 SV=1
6	AFDB:P40327	0.778	0.783	1.077E-65	437	0.714	0.719	P40327.pdb.gz	PRS4_YEAST 26S proteasome regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT2 PE=1 SV=3
7	AFDB:Q386D8	0.767	0.772	8.173E-65	437	0.702	0.707	Q386D8.pdb.gz	Q386D8_TRYB2 Proteasome regulatory ATPase subunit 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1220 PE=3 SV=1
8	PDB:6msjB	0.787	0.839	2.835E-64	411	0.934	1.000	6msjB.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
9	PDB:5mp9I	0.714	0.809	4.030E-56	385	0.655	0.748	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
10	AFDB:Q9SEI4	0.717	0.770	1.042E-50	408	0.430	0.463	Q9SEI4.pdb.gz	PRS6B_ARATH 26S proteasome regulatory subunit 6B homolog OS=Arabidopsis thaliana OX=3702 GN=RPT3 PE=1 SV=1
11	AFDB:P34123	0.725	0.788	1.582E-50	403	0.443	0.484	P34123.pdb.gz	PRS6B_DICDI 26S proteasome regulatory subunit 6B homolog OS=Dictyostelium discoideum OX=44689 GN=psmC4 PE=1 SV=1
12	AFDB:Q9V405	0.663	0.703	6.611E-50	413	0.434	0.462	Q9V405.pdb.gz	Q9V405_DROME 26S proteasome regulatory complex subunit p48A OS=Drosophila melanogaster OX=7227 GN=Rpt3 PE=1 SV=1
13	PDB:5l4gM	0.717	0.758	1.091E-42	415	0.393	0.417	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
14	PDB:6fvtK	0.642	0.710	6.922E-42	394	0.414	0.462	6fvtK.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
15	PDB:5l4gL	0.710	0.798	9.897E-42	389	0.348	0.393	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
16	PDB:6fvtM	0.719	0.751	1.115E-41	421	0.398	0.416	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
17	PDB:5l4gK	0.650	0.720	2.893E-41	393	0.425	0.476	5l4gK.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
18	PDB:5mp9M	0.723	0.829	2.329E-40	381	0.386	0.446	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:5mp9L	0.706	0.796	1.236E-39	388	0.359	0.407	5mp9L.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
20	PDB:6msgF	0.707	0.783	8.320E-39	395	0.398	0.443	6msgF.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O16368	0.0	719	443	0.836	0.831	PRS4_CAEEL Probable 26S proteasome regulatory subunit 4 OS=Caenorhabditis elegans OX=6239 GN=rpt-2 PE=3 SV=1
2	P36612	0.0	649	448	0.736	0.723	PRS4_SCHPO 26S proteasome regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mts2 PE=2 SV=1
3	P40327	0.0	621	437	0.714	0.719	PRS4_YEAST 26S proteasome regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT2 PE=1 SV=3
4	P48601	0.0	798	439	0.914	0.916	PRS4_DROME 26S proteasome regulatory subunit 4 OS=Drosophila melanogaster OX=7227 GN=Rpt2 PE=1 SV=2
5	P62191	0.0	891	440	1.000	1.000	PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
6	P62192	0.0	891	440	1.000	1.000	PRS4_MOUSE 26S proteasome regulatory subunit 4 OS=Mus musculus OX=10090 GN=Psmc1 PE=1 SV=1
7	P62193	0.0	891	440	1.000	1.000	PRS4_RAT 26S proteasome regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Psmc1 PE=1 SV=1
8	Q386D8	0.0	596	437	0.711	0.716	Q386D8_TRYB2 Proteasome regulatory ATPase subunit 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1220 PE=3 SV=1
9	Q53HB3	0.0	890	440	0.998	0.998	Q53HB3_HUMAN Proteasome 26S ATPase subunit 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
10	Q53XL8	0.0	891	440	1.000	1.000	Q53XL8_HUMAN Proteasome (Prosome, macropain) 26S subunit, ATPase, 1 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
11	Q55BV5	0.0	636	439	0.714	0.715	PRS4_DICDI 26S proteasome regulatory subunit 4 homolog OS=Dictyostelium discoideum OX=44689 GN=psmC1 PE=1 SV=1
12	Q9NC99	0.0	593	437	0.707	0.712	Q9NC99_9TRYP Proteasome regulatory ATPase subunit 2 OS=Trypanosoma brucei OX=5691 GN=Rpt2 PE=3 SV=1
13	Q9SL67	0.0	705	443	0.777	0.772	PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT2B PE=1 SV=1
14	Q9SZD4	0.0	700	443	0.777	0.772	PRS4A_ARATH 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT2A PE=1 SV=1
15	Q9V405	1.72e-137	402	413	0.423	0.450	Q9V405_DROME 26S proteasome regulatory complex subunit p48A OS=Drosophila melanogaster OX=7227 GN=Rpt3 PE=1 SV=1
16	A8K2M0	1.17e-136	400	418	0.425	0.447	A8K2M0_HUMAN Proteasome (Prosome, macropain) 26S subunit, ATPase, 4, isoform CRA_b OS=Homo sapiens OX=9606 GN=PSMC4 PE=2 SV=1
17	P43686	1.17e-136	400	418	0.425	0.447	PRS6B_HUMAN 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2
18	P54775	1.50e-136	400	418	0.425	0.447	PRS6B_MOUSE 26S proteasome regulatory subunit 6B OS=Mus musculus OX=10090 GN=Psmc4 PE=1 SV=2
19	Q63570	1.50e-136	400	418	0.425	0.447	PRS6B_RAT 26S proteasome regulatory subunit 6B OS=Rattus norvegicus OX=10116 GN=Psmc4 PE=1 SV=1
20	Q9SEI4	4.55e-135	396	408	0.414	0.446	PRS6B_ARATH 26S proteasome regulatory subunit 6B homolog OS=Arabidopsis thaliana OX=3702 GN=RPT3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.1e-39	147.3	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	1.1e+02	14.0	AAA domain
3	PF13173 AAA_14	33	15.9	AAA domain
4	PF13191 AAA_16	0.34	22.8	AAA ATPase domain
5	PF13238 AAA_18	8.8	18.3	AAA domain
6	PF07724 AAA_2	0.0011	30.6	AAA domain (Cdc48 subfamily)
7	PF13401 AAA_22	0.0072	28.1	AAA domain
8	PF13479 AAA_24	1.8e+02	13.2	AAA domain
9	PF13481 AAA_25	11	17.0	AAA domain
10	PF13521 AAA_28	20	16.9	AAA domain
11	PF07726 AAA_3	22	16.4	ATPase family associated with various cellular activities (AAA)
12	PF13604 AAA_30	2.6e+02	12.7	AAA domain
13	PF13671 AAA_33	14	17.3	AAA domain
14	PF07728 AAA_5	0.22	23.0	AAA domain (dynein-related subfamily)
15	PF12775 AAA_7	70	14.4	P-loop containing dynein motor region
16	PF17862 AAA_lid_3	2.7e-07	41.6	AAA+ lid domain
17	PF00005 ABC_tran	3.8e+02	13.0	ABC transporter
18	PF06745 ATPase	17	16.2	KaiC
19	PF01637 ATPase_2	2.9e+02	12.8	ATPase domain predominantly from Archaea
20	PF04977 DivIC	3e+02	12.6	Septum formation initiator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008819971.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008819795.1	0.999	26S proteasome non-ATPase regulatory subunit 6
2	1026970.XP_008821634.1	0.999	Proteasome subunit alpha type-4
3	1026970.XP_008826446.1	0.999	Proteasome subunit beta 4
4	1026970.XP_008826461.1	0.999	Proteasome 26S subunit, non-ATPase 4
5	1026970.XP_008827637.1	0.999	26S proteasome non-ATPase regulatory subunit 3
6	1026970.XP_008828981.1	0.999	Proteasome 26S subunit, ATPase 2
7	1026970.XP_008829509.1	0.999	26S proteasome non-ATPase regulatory subunit 2
8	1026970.XP_008830337.1	0.999	Proteasome subunit beta type-2
9	1026970.XP_008831132.1	0.999	Proteasome subunit alpha type-6
10	1026970.XP_008831920.1	0.999	26S proteasome non-ATPase regulatory subunit 7
11	1026970.XP_008834501.1	0.999	Proteasome subunit alpha type-2
12	1026970.XP_008836288.1	0.999	26S proteasome non-ATPase regulatory subunit 1
13	1026970.XP_008837735.1	0.999	Proteasome subunit alpha type-3
14	1026970.XP_008837793.1	0.999	Proteasome 26S subunit, ATPase 6
15	1026970.XP_008838115.1	0.999	Proteasome subunit beta type-5
16	1026970.XP_008841416.1	0.999	Proteasome 26S subunit, non-ATPase 12
17	1026970.XP_008841452.1	0.999	Proteasome subunit alpha 7
18	1026970.XP_008841625.1	0.999	Proteasome subunit beta 1
19	1026970.XP_008841832.1	0.999	Proteasome 26S subunit, ATPase 3
20	1026970.XP_008843496.1	0.999	Proteasome subunit beta 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.777	catalytic activity
GO:0140657	0.724	ATP-dependent activity
GO:0097159	0.370	organic cyclic compound binding
GO:1901363	0.345	heterocyclic compound binding
GO:0003676	0.320	nucleic acid binding
GO:0016787	0.309	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.955	regulation of cellular process
GO:0009987	0.897	cellular process
GO:1901214	0.837	regulation of neuron death
GO:0071704	0.811	organic substance metabolic process
GO:0048523	0.802	negative regulation of cellular process
GO:0044238	0.758	primary metabolic process
GO:0043170	0.751	macromolecule metabolic process
GO:0006807	0.749	nitrogen compound metabolic process
GO:0044237	0.578	cellular metabolic process
GO:0019538	0.541	protein metabolic process
GO:0050896	0.368	response to stimulus
GO:0044260	0.322	cellular macromolecule metabolic process
GO:0019222	0.319	regulation of metabolic process
GO:1901215	0.317	negative regulation of neuron death
GO:0030163	0.300	protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.996	protein-containing complex
GO:0005829	0.996	cytosol
GO:0070013	0.995	intracellular organelle lumen
GO:0031981	0.990	nuclear lumen
GO:0005654	0.973	nucleoplasm
GO:1902494	0.835	catalytic complex
GO:0016020	0.828	membrane
GO:0140535	0.785	intracellular protein-containing complex
GO:1905368	0.723	peptidase complex
GO:0000502	0.703	proteasome complex
GO:0022624	0.325	proteasome accessory complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.309	Hydrolases.

[back to server]