StarFunc result for job id P62195

User Input

>input (406 residues)
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62195	1.000	1.000	5.642E-81	406	1.000	1.000	P62195.pdb.gz	PRS8_HUMAN 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1
2	AFDB:Q94BQ2	0.947	0.918	2.093E-71	419	0.803	0.778	Q94BQ2.pdb.gz	PRS8B_ARATH 26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1
3	AFDB:Q01939	0.924	0.926	1.403E-69	405	0.739	0.741	Q01939.pdb.gz	PRS8_YEAST 26S proteasome regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT6 PE=1 SV=4
4	AFDB:P41836	0.919	0.925	9.910E-69	403	0.771	0.777	P41836.pdb.gz	PRS8_SCHPO 26S proteasome regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=let1 PE=3 SV=1
5	AFDB:Q38A02	0.940	0.936	7.536E-66	408	0.709	0.706	Q38A02.pdb.gz	Q38A02_TRYB2 Proteasome regulatory ATPase subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0580 PE=3 SV=1
6	PDB:6epcJ	0.599	0.599	3.632E-59	406	1.000	1.000	6epcJ.pdb.gz	In Situ Structure of Neuronal C9orf72 Poly-GA Aggregates Reveals Proteasome Recruitment.
7	PDB:6fvtJ	0.584	0.585	6.970E-51	405	0.727	0.728	6fvtJ.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
8	AFDB:G3V6W6	0.779	0.785	2.466E-49	403	0.453	0.457	G3V6W6.pdb.gz	G3V6W6_RAT Proteasome 26S subunit, ATPase 6 OS=Rattus norvegicus OX=10116 GN=Psmc6 PE=1 SV=1
9	AFDB:Q58576	0.803	0.760	2.466E-49	430	0.468	0.442	Q58576.pdb.gz	PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=pan PE=1 SV=1
10	AFDB:P62191	0.806	0.746	5.995E-49	440	0.446	0.411	P62191.pdb.gz	PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
11	AFDB:O17071	0.776	0.776	1.220E-48	406	0.433	0.433	O17071.pdb.gz	PRS10_CAEEL Probable 26S proteasome regulatory subunit 10B OS=Caenorhabditis elegans OX=6239 GN=rpt-4 PE=1 SV=2
12	AFDB:Q38BP7	0.758	0.771	1.220E-48	399	0.419	0.426	Q38BP7.pdb.gz	Q38BP7_TRYB2 Protease regulatory ATPase subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3930 PE=3 SV=1
13	PDB:5vhiC	0.475	0.542	1.233E-45	350	0.860	0.997	5vhiC.pdb.gz
14	PDB:5l4gL	0.764	0.795	7.288E-45	389	0.441	0.460	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
15	PDB:6wjnC	0.702	0.811	7.343E-44	345	0.842	0.991	6wjnC.pdb.gz	Cryo-EM Reveals Unanchored M1-Ubiquitin Chain Binding at hRpn11 of the 26S Proteasome.
16	PDB:5l4gM	0.758	0.743	1.812E-41	415	0.416	0.407	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
17	PDB:5mp9I	0.708	0.743	2.605E-40	385	0.411	0.434	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
18	PDB:5mp9L	0.756	0.789	2.197E-39	388	0.399	0.418	5mp9L.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:6msjB	0.755	0.747	2.197E-39	411	0.426	0.421	6msjB.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
20	PDB:6fvtM	0.756	0.730	2.784E-39	421	0.401	0.387	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18413	0.0	764	405	0.916	0.919	PRS8_DROME 26S proteasome regulatory subunit 8 OS=Drosophila melanogaster OX=7227 GN=Rpt6 PE=1 SV=2
2	P41836	0.0	616	403	0.756	0.762	PRS8_SCHPO 26S proteasome regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=let1 PE=3 SV=1
3	P62195	0.0	827	406	1.000	1.000	PRS8_HUMAN 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1
4	P62196	0.0	827	406	1.000	1.000	PRS8_MOUSE 26S proteasome regulatory subunit 8 OS=Mus musculus OX=10090 GN=Psmc5 PE=1 SV=1
5	P62198	0.0	827	406	1.000	1.000	PRS8_RAT 26S proteasome regulatory subunit 8 OS=Rattus norvegicus OX=10116 GN=Psmc5 PE=1 SV=1
6	Q01939	0.0	629	405	0.734	0.736	PRS8_YEAST 26S proteasome regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT6 PE=1 SV=4
7	Q38A02	0.0	585	408	0.707	0.703	Q38A02_TRYB2 Proteasome regulatory ATPase subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0580 PE=3 SV=1
8	Q94BQ2	0.0	675	419	0.800	0.776	PRS8B_ARATH 26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1
9	Q9C5U3	0.0	677	419	0.803	0.778	PRS8A_ARATH 26S proteasome regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT6A PE=1 SV=1
10	Q9NC95	0.0	577	408	0.700	0.696	Q9NC95_9TRYP Proteasome regulatory ATPase subunit 6 OS=Trypanosoma brucei OX=5691 GN=Rpt6 PE=3 SV=1
11	Q58576	2.06e-123	365	430	0.446	0.421	PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=pan PE=1 SV=1
12	P46471	6.30e-121	359	433	0.429	0.402	PRS7_MOUSE 26S proteasome regulatory subunit 7 OS=Mus musculus OX=10090 GN=Psmc2 PE=1 SV=5
13	A0A140VK70	7.42e-121	359	433	0.429	0.402	A0A140VK70_HUMAN Testis secretory sperm-binding protein Li 197a OS=Homo sapiens OX=9606 PE=2 SV=1
14	P35998	7.42e-121	359	433	0.429	0.402	PRS7_HUMAN 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3
15	Q9SSB5	7.68e-121	359	426	0.431	0.411	PRS7A_ARATH 26S proteasome regulatory subunit 7 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT1A PE=1 SV=1
16	Q7KMQ0	9.12e-121	359	433	0.443	0.416	Q7KMQ0_DROME 26S proteasome regulatory complex subunit p48B OS=Drosophila melanogaster OX=7227 GN=Rpt1 PE=1 SV=1
17	Q63347	1.10e-119	356	433	0.426	0.400	PRS7_RAT 26S proteasome regulatory subunit 7 OS=Rattus norvegicus OX=10116 GN=Psmc2 PE=1 SV=3
18	Q18787	1.84e-118	353	435	0.419	0.391	PRS7_CAEEL 26S proteasome regulatory subunit 7 OS=Caenorhabditis elegans OX=6239 GN=rpt-1 PE=1 SV=1
19	P48601	4.83e-118	352	439	0.436	0.403	PRS4_DROME 26S proteasome regulatory subunit 4 OS=Drosophila melanogaster OX=7227 GN=Rpt2 PE=1 SV=2
20	P62191	1.18e-117	351	440	0.433	0.400	PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.7e-39	146.7	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	3.8e+02	12.2	AAA domain
3	PF13173 AAA_14	71	14.9	AAA domain
4	PF13191 AAA_16	0.015	27.2	AAA ATPase domain
5	PF13207 AAA_17	87	15.0	AAA domain
6	PF13238 AAA_18	9.8	18.2	AAA domain
7	PF13245 AAA_19	3.6e+02	12.8	AAA domain
8	PF07724 AAA_2	0.00074	31.2	AAA domain (Cdc48 subfamily)
9	PF13401 AAA_22	0.074	24.8	AAA domain
10	PF13479 AAA_24	65	14.7	AAA domain
11	PF13481 AAA_25	1.5e+02	13.4	AAA domain
12	PF13521 AAA_28	56	15.4	AAA domain
13	PF07726 AAA_3	21	16.4	ATPase family associated with various cellular activities (AAA)
14	PF13671 AAA_33	6.5	18.4	AAA domain
15	PF07728 AAA_5	0.009	27.5	AAA domain (dynein-related subfamily)
16	PF12775 AAA_7	87	14.1	P-loop containing dynein motor region
17	PF17862 AAA_lid_3	5.8e-09	47.0	AAA+ lid domain
18	PF06745 ATPase	27	15.6	KaiC
19	PF20030 bpMoxR	1.1e+02	13.3	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
20	PF05673 DUF815	1e+02	13.4	Protein of unknown function (DUF815)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008844808.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008819795.1	0.999	26S proteasome non-ATPase regulatory subunit 6
2	1026970.XP_008819971.1	0.999	Proteasome 26S subunit, ATPase 1
3	1026970.XP_008821634.1	0.999	Proteasome subunit alpha type-4
4	1026970.XP_008822797.1	0.999	Proteasome subunit beta type-7
5	1026970.XP_008826446.1	0.999	Proteasome subunit beta 4
6	1026970.XP_008826461.1	0.999	Proteasome 26S subunit, non-ATPase 4
7	1026970.XP_008827637.1	0.999	26S proteasome non-ATPase regulatory subunit 3
8	1026970.XP_008828981.1	0.999	Proteasome 26S subunit, ATPase 2
9	1026970.XP_008829509.1	0.999	26S proteasome non-ATPase regulatory subunit 2
10	1026970.XP_008830337.1	0.999	Proteasome subunit beta type-2
11	1026970.XP_008831132.1	0.999	Proteasome subunit alpha type-6
12	1026970.XP_008831920.1	0.999	26S proteasome non-ATPase regulatory subunit 7
13	1026970.XP_008834501.1	0.999	Proteasome subunit alpha type-2
14	1026970.XP_008836288.1	0.999	26S proteasome non-ATPase regulatory subunit 1
15	1026970.XP_008837735.1	0.999	Proteasome subunit alpha type-3
16	1026970.XP_008837793.1	0.999	Proteasome 26S subunit, ATPase 6
17	1026970.XP_008838115.1	0.999	Proteasome subunit beta type-5
18	1026970.XP_008841416.1	0.999	Proteasome 26S subunit, non-ATPase 12
19	1026970.XP_008841625.1	0.999	Proteasome subunit beta 1
20	1026970.XP_008841832.1	0.999	Proteasome 26S subunit, ATPase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140657	0.919	ATP-dependent activity
GO:0003824	0.900	catalytic activity
GO:0008134	0.597	transcription factor binding
GO:0140296	0.505	general transcription initiation factor binding
GO:0016787	0.456	hydrolase activity
GO:0005102	0.385	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0009987	0.984	cellular process
GO:0071704	0.978	organic substance metabolic process
GO:0050794	0.967	regulation of cellular process
GO:0044238	0.965	primary metabolic process
GO:0019222	0.965	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0044237	0.938	cellular metabolic process
GO:0043170	0.899	macromolecule metabolic process
GO:1901564	0.895	organonitrogen compound metabolic process
GO:0080090	0.888	regulation of primary metabolic process
GO:0051171	0.888	regulation of nitrogen compound metabolic process
GO:0019538	0.881	protein metabolic process
GO:0048519	0.840	negative regulation of biological process
GO:0044260	0.824	cellular macromolecule metabolic process
GO:0006508	0.816	proteolysis
GO:0051603	0.797	proteolysis involved in protein catabolic process
GO:0031323	0.793	regulation of cellular metabolic process
GO:0010498	0.785	proteasomal protein catabolic process
GO:0048518	0.783	positive regulation of biological process
GO:0009889	0.748	regulation of biosynthetic process
GO:0043632	0.717	modification-dependent macromolecule catabolic process
GO:0010604	0.701	positive regulation of macromolecule metabolic process
GO:0019219	0.700	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.685	regulation of gene expression
GO:0051173	0.640	positive regulation of nitrogen compound metabolic process
GO:0048522	0.622	positive regulation of cellular process
GO:0031326	0.606	regulation of cellular biosynthetic process
GO:0010556	0.603	regulation of macromolecule biosynthetic process
GO:0050896	0.559	response to stimulus
GO:0019941	0.535	modification-dependent protein catabolic process
GO:0051252	0.532	regulation of RNA metabolic process
GO:0006355	0.523	regulation of DNA-templated transcription
GO:0009894	0.469	regulation of catabolic process
GO:0006511	0.358	ubiquitin-dependent protein catabolic process
GO:0048523	0.345	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:1902494	0.994	catalytic complex
GO:0140535	0.992	intracellular protein-containing complex
GO:0005829	0.990	cytosol
GO:0005654	0.983	nucleoplasm
GO:0000502	0.975	proteasome complex
GO:0022624	0.542	proteasome accessory complex
GO:0005838	0.437	proteasome regulatory particle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.456	Hydrolases.

[back to server]