StarFunc result for job id P62256

User Input

>input (183 residues)
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDK
YPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPID
PLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQD
MEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D1L5	0.920	0.920	7.577E-35	183	1.000	1.000	A4D1L5.pdb.gz	A4D1L5_HUMAN Ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) OS=Homo sapiens OX=9606 GN=UBE2H PE=1 SV=1
2	AFDB:Q7JW03	0.873	0.873	5.030E-29	183	0.716	0.716	Q7JW03.pdb.gz	Q7JW03_DROME CG2257 OS=Drosophila melanogaster OX=7227 GN=UbcE2H PE=1 SV=1
3	AFDB:Q9P7R4	0.854	0.849	1.460E-24	184	0.525	0.522	Q9P7R4.pdb.gz	UBC8_SCHPO Ubiquitin-conjugating enzyme E2 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc8 PE=3 SV=1
4	AFDB:P42748	0.812	0.795	4.756E-24	187	0.503	0.492	P42748.pdb.gz	UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabidopsis thaliana OX=3702 GN=UBC4 PE=2 SV=2
5	AFDB:P28263	0.835	0.702	5.353E-24	218	0.530	0.445	P28263.pdb.gz	UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC8 PE=1 SV=2
6	AFDB:P42749	0.791	0.782	1.224E-23	185	0.508	0.503	P42749.pdb.gz	UBC5_ARATH Ubiquitin-conjugating enzyme E2 5 OS=Arabidopsis thaliana OX=3702 GN=UBC5 PE=2 SV=2
7	AFDB:P42750	0.803	0.803	1.298E-23	183	0.470	0.470	P42750.pdb.gz	UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabidopsis thaliana OX=3702 GN=UBC6 PE=2 SV=2
8	AFDB:Q382E3	0.832	0.707	1.462E-22	216	0.486	0.412	Q382E3.pdb.gz	Q382E3_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5510 PE=3 SV=1
9	AFDB:P52478	0.727	0.695	2.813E-14	192	0.273	0.260	P52478.pdb.gz	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
10	AFDB:Q94490	0.744	0.910	8.144E-14	148	0.219	0.270	Q94490.pdb.gz	UBCB_DICDI Ubiquitin conjugating enzyme E2 B OS=Dictyostelium discoideum OX=44689 GN=ubcB PE=1 SV=1
11	PDB:6cyrA	0.699	0.826	9.041E-13	153	0.240	0.288	6cyrA.pdb.gz
12	PDB:2aakA	0.699	0.839	1.632E-12	150	0.235	0.287	2aakA.pdb.gz
13	PDB:4ii2C	0.695	0.840	1.731E-12	149	0.246	0.302	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
14	PDB:3ptfA	0.700	0.828	2.067E-12	153	0.268	0.320	3ptfA.pdb.gz
15	PDB:6xodA	0.701	0.822	2.067E-12	154	0.208	0.247	6xodA.pdb.gz
16	PDB:3bzhA	0.711	0.800	2.192E-12	161	0.230	0.261	3bzhA.pdb.gz
17	PDB:4ddgA	0.687	0.335	2.777E-12	399	0.251	0.115	4ddgA.pdb.gz
18	PDB:5aieB	0.726	0.873	3.315E-12	150	0.251	0.307	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
19	PDB:6zhtB	0.696	0.820	4.453E-12	153	0.279	0.333	6zhtB.pdb.gz
20	PDB:3e46A	0.720	0.657	5.640E-12	202	0.279	0.252	3e46A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D1L5	1.14e-136	380	183	1.000	1.000	A4D1L5_HUMAN Ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) OS=Homo sapiens OX=9606 GN=UBE2H PE=1 SV=1
2	P62256	1.14e-136	380	183	1.000	1.000	UBE2H_HUMAN Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens OX=9606 GN=UBE2H PE=1 SV=1
3	P62257	1.14e-136	380	183	1.000	1.000	UBE2H_MOUSE Ubiquitin-conjugating enzyme E2 H OS=Mus musculus OX=10090 GN=Ube2h PE=1 SV=1
4	Q7JW03	7.21e-101	290	183	0.787	0.787	Q7JW03_DROME CG2257 OS=Drosophila melanogaster OX=7227 GN=UbcE2H PE=1 SV=1
5	Q9P7R4	2.58e-67	205	184	0.508	0.505	UBC8_SCHPO Ubiquitin-conjugating enzyme E2 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc8 PE=3 SV=1
6	P42749	1.16e-65	201	185	0.525	0.519	UBC5_ARATH Ubiquitin-conjugating enzyme E2 5 OS=Arabidopsis thaliana OX=3702 GN=UBC5 PE=2 SV=2
7	P42748	2.01e-63	195	187	0.486	0.476	UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabidopsis thaliana OX=3702 GN=UBC4 PE=2 SV=2
8	P28263	1.01e-61	192	218	0.492	0.413	UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC8 PE=1 SV=2
9	P42750	2.50e-60	187	183	0.464	0.464	UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabidopsis thaliana OX=3702 GN=UBC6 PE=2 SV=2
10	Q382E3	2.10e-57	181	216	0.481	0.407	Q382E3_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5510 PE=3 SV=1
11	P63146	1.39e-26	100	152	0.268	0.322	UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1
12	P63147	1.39e-26	100	152	0.268	0.322	UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus OX=10090 GN=Ube2b PE=1 SV=1
13	P63149	1.39e-26	100	152	0.268	0.322	UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus OX=10116 GN=Ube2b PE=2 SV=1
14	P49459	6.65e-26	99.0	152	0.257	0.309	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
15	Q9Z255	6.65e-26	99.0	152	0.257	0.309	UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus OX=10090 GN=Ube2a PE=1 SV=1
16	P35128	3.18e-25	97.1	151	0.262	0.318	UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster OX=7227 GN=ben PE=1 SV=1
17	P25865	7.02e-25	96.3	152	0.257	0.309	UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana OX=3702 GN=UBC1 PE=1 SV=1
18	O74810	7.26e-25	98.2	217	0.230	0.194	UBC1_SCHPO Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc1 PE=3 SV=2
19	P42745	7.32e-25	96.3	152	0.257	0.309	UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana OX=3702 GN=UBC2 PE=2 SV=1
20	P52478	1.61e-24	96.7	192	0.268	0.255	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00179 UQ_con	4.3e-34	128.6	Ubiquitin-conjugating enzyme
2	PF01099 Uteroglobin	5.5e+02	12.4	Uteroglobin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008844573.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008822307.1	0.910	Ubiquitin like modifier activating enzyme 1
2	1026970.XP_008852047.1	0.858	Ubiquitin like modifier activating enzyme 6
3	1026970.XP_008825361.1	0.849	Ubiquitin like modifier activating enzyme 3
4	1026970.XP_008850792.1	0.847	Ubiquitin-conjugating enzyme E2 J2
5	1026970.XP_008847117.1	0.841	Ubiquitin conjugating enzyme E2 W
6	1026970.XP_008830072.1	0.830	Ubiquitin-conjugating enzyme E2 J1
7	1026970.XP_008851389.1	0.830	Ubiquitin like modifier activating enzyme 7
8	1026970.XP_008829290.1	0.795	Ubiquitin-conjugating enzyme E2 U
9	1026970.XP_008853122.1	0.757	Autophagy related 7
10	1026970.XP_008822015.1	0.740	Tripartite motif-containing protein 72
11	1026970.XP_008836518.1	0.735	Ubiquitin conjugating enzyme E2 Z
12	1026970.XP_008830889.1	0.734	Ubiquitin-like modifier-activating enzyme 5
13	1026970.XP_008853857.1	0.731	Ubiquitin conjugating enzyme E2 G1
14	1026970.XP_008854115.1	0.714	Ubiquitin-conjugating enzyme E2 Q1
15	1026970.XP_008824377.1	0.703	Ubiquitin-conjugating enzyme E2 D3
16	1026970.XP_008829387.1	0.700	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 177 Proteins, and 64% coverage of the annotated genomic feature by RNAseq alignments
17	1026970.XP_008837468.1	0.700	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 ESTs, 77 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
18	1026970.XP_008845333.1	0.700	polyubiquitin-B
19	1026970.XP_008838643.1	0.696	Ubiquitin conjugating enzyme E2 G2
20	1026970.XP_008831376.1	0.693	Ubiquitin conjugating enzyme E2 E1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061650	0.602	ubiquitin-like protein conjugating enzyme activity
GO:0061631	0.511	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019941	0.995	modification-dependent protein catabolic process
GO:0006511	0.994	ubiquitin-dependent protein catabolic process
GO:0036211	0.665	protein modification process
GO:0032446	0.550	protein modification by small protein conjugation
GO:0016567	0.539	protein ubiquitination
GO:0000209	0.419	protein polyubiquitination
GO:0050789	0.376	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.985	cytosol
GO:0032991	0.466	protein-containing complex
GO:0043231	0.399	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.511	E2 ubiquitin-conjugating enzyme.

[back to server]