StarFunc result for job id P62312

User Input

>input (80 residues)
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKY
GDAFIRGNNVLYISTQKRRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62312	1.000	1.000	7.723E-15	80	1.000	1.000	P62312.pdb.gz	LSM6_HUMAN U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens OX=9606 GN=LSM6 PE=1 SV=1
2	AFDB:O22823	0.931	0.822	1.426E-12	91	0.775	0.681	O22823.pdb.gz	LSM6B_ARATH Sm-like protein LSM36B OS=Arabidopsis thaliana OX=3702 GN=LSM6B PE=1 SV=1
3	AFDB:Q9M1Z3	0.906	0.799	2.224E-12	91	0.800	0.703	Q9M1Z3.pdb.gz	LSM6A_ARATH Sm-like protein LSM6A OS=Arabidopsis thaliana OX=3702 GN=LSM6A PE=1 SV=1
4	AFDB:Q9W2P5	0.906	0.917	3.280E-12	79	0.850	0.861	Q9W2P5.pdb.gz	Q9W2P5_DROME RE43665p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9344 PE=1 SV=1
5	PDB:6qw666	0.806	0.888	1.639E-11	72	0.900	1.000	6qw666.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
6	AFDB:Q9UUI1	0.886	0.944	4.713E-11	75	0.575	0.613	Q9UUI1.pdb.gz	LSM6_SCHPO U6 snRNA-associated Sm-like protein LSm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm6 PE=1 SV=1
7	PDB:3swnQ	0.800	0.869	1.555E-9	73	0.575	0.630	3swnQ.pdb.gz	Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
8	AFDB:Q24297	0.891	0.814	1.740E-9	88	0.400	0.364	Q24297.pdb.gz	RUXF_DROME Small nuclear ribonucleoprotein F OS=Drosophila melanogaster OX=7227 GN=SmF PE=1 SV=2
9	AFDB:O59734	0.894	0.916	3.031E-9	78	0.388	0.397	O59734.pdb.gz	RUXF_SCHPO Small nuclear ribonucleoprotein F OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smf1 PE=1 SV=1
10	AFDB:P62306	0.888	0.829	3.785E-9	86	0.463	0.430	P62306.pdb.gz	RUXF_HUMAN Small nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=SNRPF PE=1 SV=1
11	AFDB:F4JPK5	0.880	0.740	4.001E-9	96	0.412	0.344	F4JPK5.pdb.gz	F4JPK5_ARATH Sm protein F OS=Arabidopsis thaliana OX=3702 GN=RUXF PE=1 SV=1
12	AFDB:P34659	0.891	0.841	4.471E-9	85	0.375	0.353	P34659.pdb.gz	RUXF_CAEEL Probable small nuclear ribonucleoprotein F OS=Caenorhabditis elegans OX=6239 GN=snr-5 PE=1 SV=1
13	PDB:5vsuF	0.816	0.846	3.893E-8	77	0.438	0.455	5vsuF.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	PDB:7b9vq	0.869	0.924	8.012E-8	75	0.375	0.400	7b9vq.pdb.gz	Structural basis for conformational equilibrium of the catalytic spliceosome.
15	PDB:3jb9I	0.863	0.942	1.249E-7	73	0.362	0.397	3jb9I.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:3pgwF	0.861	0.813	1.743E-7	85	0.450	0.424	3pgwF.pdb.gz
17	PDB:3jb9E	0.785	0.648	1.151E-6	98	0.200	0.163	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
18	PDB:3jb9J	0.751	0.818	2.005E-6	73	0.338	0.370	3jb9J.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:3bw1A	0.788	0.736	2.504E-6	86	0.312	0.291	3bw1A.pdb.gz
20	PDB:4m75F	0.744	0.788	3.494E-6	75	0.263	0.280	4m75F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62312	1.09e-54	165	80	1.000	1.000	LSM6_HUMAN U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens OX=9606 GN=LSM6 PE=1 SV=1
2	Q9W2P5	5.07e-44	138	79	0.825	0.835	Q9W2P5_DROME RE43665p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9344 PE=1 SV=1
3	Q9M1Z3	7.31e-43	135	91	0.800	0.703	LSM6A_ARATH Sm-like protein LSM6A OS=Arabidopsis thaliana OX=3702 GN=LSM6A PE=1 SV=1
4	O22823	1.78e-42	134	91	0.762	0.670	LSM6B_ARATH Sm-like protein LSM36B OS=Arabidopsis thaliana OX=3702 GN=LSM6B PE=1 SV=1
5	Q9UUI1	1.94e-32	108	75	0.575	0.613	LSM6_SCHPO U6 snRNA-associated Sm-like protein LSm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm6 PE=1 SV=1
6	P62306	4.04e-19	75.9	86	0.425	0.395	RUXF_HUMAN Small nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=SNRPF PE=1 SV=1
7	F4JPK5	5.39e-18	73.2	96	0.412	0.344	F4JPK5_ARATH Sm protein F OS=Arabidopsis thaliana OX=3702 GN=RUXF PE=1 SV=1
8	Q24297	1.25e-16	69.3	88	0.400	0.364	RUXF_DROME Small nuclear ribonucleoprotein F OS=Drosophila melanogaster OX=7227 GN=SmF PE=1 SV=2
9	P34659	7.94e-16	67.4	85	0.375	0.353	RUXF_CAEEL Probable small nuclear ribonucleoprotein F OS=Caenorhabditis elegans OX=6239 GN=snr-5 PE=1 SV=1
10	O59734	4.17e-15	65.5	78	0.388	0.397	RUXF_SCHPO Small nuclear ribonucleoprotein F OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smf1 PE=1 SV=1
11	Q06406	4.52e-13	60.5	86	0.412	0.384	LSM6_YEAST U6 snRNA-associated Sm-like protein LSm6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM6 PE=1 SV=2
12	P54999	8.03e-12	57.4	86	0.375	0.349	RUXF_YEAST Small nuclear ribonucleoprotein F OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMX3 PE=1 SV=1
13	Q570S3	8.79e-11	53.9	61	0.300	0.393	Q570S3_ARATH Sm protein F OS=Arabidopsis thaliana OX=3702 GN=At2g14285 PE=2 SV=1
14	Q38DY4	7.86e-08	47.0	75	0.325	0.347	Q38DY4_TRYB2 Sm protein F OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1695 PE=3 SV=1
15	Q9GYZ7	7.86e-08	47.0	75	0.325	0.347	Q9GYZ7_9TRYP Sm protein F OS=Trypanosoma brucei OX=5691 GN=Sm-F PE=2 SV=1
16	O74966	1.99e-06	43.1	77	0.362	0.377	RUXG_SCHPO Small nuclear ribonucleoprotein G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smg1 PE=1 SV=1
17	Q9VXE0	2.56e-06	43.1	76	0.287	0.303	RUXG_DROME Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster OX=7227 GN=SNRPG PE=1 SV=1
18	O14352	3.09e-06	43.5	121	0.300	0.198	LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm4 PE=1 SV=1
19	B5DEP7	3.82e-06	42.4	76	0.263	0.276	B5DEP7_RAT Small nuclear ribonucleoprotein G OS=Rattus norvegicus OX=10116 GN=LOC687679 PE=2 SV=1
20	P62308	3.82e-06	42.4	76	0.263	0.276	RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01423 LSM	2.8e-16	70.3	LSM domain
2	PF12701 LSM14	1.2e+02	14.1	Scd6-like Sm domain
3	PF14438 SM-ATX	0.18	23.3	Ataxin 2 SM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008587467.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008566459.1	0.999	LSM8 homolog, U6 small nuclear RNA associated
2	482537.XP_008570666.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008573312.1	0.999	U6 snRNA-associated Sm-like protein LSm2
4	482537.XP_008574406.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008576823.1	0.999	Small nuclear ribonucleoprotein Sm D2
6	482537.XP_008587426.1	0.999	U6 snRNA-associated Sm-like protein LSm3
7	482537.XP_008590479.1	0.999	Small nuclear ribonucleoprotein E
8	482537.XP_008591311.1	0.999	U6 snRNA-associated Sm-like protein LSm4 isoform X1
9	482537.XP_008592281.1	0.999	Small nuclear ribonucleoprotein Sm D3
10	482537.XP_008589007.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 7 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008566977.1	0.997	U4/U6 small nuclear ribonucleoprotein Prp4
12	482537.XP_008569275.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 11 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008588465.1	0.997	U4/U6.U5 tri-snRNP-associated protein 1
14	482537.XP_008572365.1	0.996	PHD finger-like domain-containing protein 5A
15	482537.XP_008582928.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 11 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	482537.XP_008583986.1	0.996	Zinc finger matrin-type protein 2
17	482537.XP_008566126.1	0.995	U5 small nuclear ribonucleoprotein 200 kDa helicase
18	482537.XP_008579317.1	0.995	Squamous cell carcinoma antigen recognized by T-cells 3
19	482537.XP_008581854.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
20	482537.XP_008589642.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0046983	0.986	protein dimerization activity
GO:0046982	0.767	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0006139	0.977	nucleobase-containing compound metabolic process
GO:0090304	0.970	nucleic acid metabolic process
GO:0016070	0.957	RNA metabolic process
GO:0000398	0.946	mRNA splicing, via spliceosome
GO:0065007	0.865	biological regulation
GO:0050789	0.850	regulation of biological process
GO:0019222	0.789	regulation of metabolic process
GO:0060255	0.765	regulation of macromolecule metabolic process
GO:0048519	0.764	negative regulation of biological process
GO:0010468	0.757	regulation of gene expression
GO:0034655	0.723	nucleobase-containing compound catabolic process
GO:0010605	0.698	negative regulation of macromolecule metabolic process
GO:0006401	0.693	RNA catabolic process
GO:0006402	0.558	mRNA catabolic process
GO:0050794	0.310	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990904	0.996	ribonucleoprotein complex
GO:0005654	0.996	nucleoplasm
GO:0140513	0.995	nuclear protein-containing complex
GO:0120114	0.994	Sm-like protein family complex
GO:0005829	0.978	cytosol
GO:0030532	0.959	small nuclear ribonucleoprotein complex
GO:0097525	0.936	spliceosomal snRNP complex
GO:0120115	0.921	Lsm2-8 complex
GO:0005681	0.896	spliceosomal complex
GO:0005684	0.852	U2-type spliceosomal complex
GO:0097526	0.690	spliceosomal tri-snRNP complex
GO:0046540	0.673	U4/U6 x U5 tri-snRNP complex
GO:0071011	0.522	precatalytic spliceosome
GO:0071005	0.494	U2-type precatalytic spliceosome
GO:1902494	0.303	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]