StarFunc result for job id P62324

User Input

>input (171 residues)
MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEK
PCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGS
ICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62324	1.000	1.000	2.388E-31	171	1.000	1.000	P62324.pdb.gz	BTG1_HUMAN Protein BTG1 OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
2	AFDB:P27049	0.722	0.781	2.463E-22	158	0.579	0.627	P27049.pdb.gz	BTG2_RAT Protein BTG2 OS=Rattus norvegicus OX=10116 GN=Btg2 PE=1 SV=1
3	AFDB:Q14106	0.647	0.327	3.030E-13	344	0.351	0.174	Q14106.pdb.gz	TOB2_HUMAN Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 SV=2
4	AFDB:Q9JM55	0.669	0.339	4.843E-13	345	0.339	0.168	Q9JM55.pdb.gz	TOB2_MOUSE Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2 SV=1
5	AFDB:Q61471	0.658	0.317	5.136E-13	362	0.339	0.160	Q61471.pdb.gz	TOB1_MOUSE Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1 SV=2
6	PDB:5ci8A	0.650	0.938	5.664E-13	117	0.310	0.453	5ci8A.pdb.gz	Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach
7	AFDB:Q7SZR1	0.647	0.349	7.741E-13	322	0.322	0.171	Q7SZR1.pdb.gz	Q7SZR1_DANRE Protein Tob1 OS=Danio rerio OX=7955 GN=tob1 PE=2 SV=1
8	AFDB:O70552	0.633	0.437	1.659E-12	250	0.275	0.188	O70552.pdb.gz	BTG4_MOUSE Protein BTG4 OS=Mus musculus OX=10090 GN=Btg4 PE=1 SV=2
9	AFDB:Q9NY30	0.639	0.494	7.618E-12	223	0.263	0.202	Q9NY30.pdb.gz	BTG4_HUMAN Protein BTG4 OS=Homo sapiens OX=9606 GN=BTG4 PE=1 SV=1
10	AFDB:O88677	0.651	0.447	8.078E-12	252	0.316	0.214	O88677.pdb.gz	BTG3_RAT Protein BTG3 OS=Rattus norvegicus OX=10116 GN=Btg3 PE=2 SV=1
11	AFDB:Q9VXJ9	0.644	0.200	1.347E-10	564	0.327	0.099	Q9VXJ9.pdb.gz	Q9VXJ9_DROME Transducer of ERBB2, isoform A OS=Drosophila melanogaster OX=7227 GN=Tob PE=3 SV=1
12	PDB:7k0yC	0.119	0.048	1.193	655	0.064	0.017	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
13	PDB:6pzkA	0.188	0.035	1.265	1361	0.105	0.013	6pzkA.pdb.gz
14	PDB:6fhsC	0.124	0.056	1.341	459	0.035	0.013	6fhsC.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.
15	PDB:6e8eA	0.136	0.058	1.508	468	0.058	0.021	6e8eA.pdb.gz
16	PDB:6u9fB	0.080	0.094	1.508	133	0.058	0.075	6u9fB.pdb.gz
17	PDB:2we6A	0.137	0.121	1.696	208	0.023	0.019	2we6A.pdb.gz
18	PDB:7z8bF	0.154	0.060	1.798	457	0.029	0.011	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
19	PDB:1uchA	0.135	0.115	1.907	206	0.035	0.029	1uchA.pdb.gz
20	PDB:2w4mA	0.293	0.211	1.907	250	0.088	0.060	2w4mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62324	9.25e-129	359	171	1.000	1.000	BTG1_HUMAN Protein BTG1 OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
2	P62325	9.25e-129	359	171	1.000	1.000	BTG1_MOUSE Protein BTG1 OS=Mus musculus OX=10090 GN=Btg1 PE=1 SV=1
3	Q6IBC8	9.25e-129	359	171	1.000	1.000	Q6IBC8_HUMAN B-cell translocation gene 1, anti-proliferative OS=Homo sapiens OX=9606 GN=BTG1 PE=1 SV=1
4	Q63073	3.53e-128	358	171	0.994	0.994	BTG1_RAT Protein BTG1 OS=Rattus norvegicus OX=10116 GN=Btg1 PE=2 SV=1
5	Q04211	2.35e-72	216	158	0.591	0.639	BTG2_MOUSE Protein BTG2 OS=Mus musculus OX=10090 GN=Btg2 PE=1 SV=1
6	P78543	3.13e-72	216	158	0.602	0.652	BTG2_HUMAN Protein BTG2 OS=Homo sapiens OX=9606 GN=BTG2 PE=1 SV=1
7	P27049	1.95e-71	214	158	0.591	0.639	BTG2_RAT Protein BTG2 OS=Rattus norvegicus OX=10116 GN=Btg2 PE=1 SV=1
8	P50616	2.83e-31	117	345	0.304	0.151	TOB1_HUMAN Protein Tob1 OS=Homo sapiens OX=9606 GN=TOB1 PE=1 SV=1
9	Q7SZR1	6.19e-31	115	322	0.287	0.152	Q7SZR1_DANRE Protein Tob1 OS=Danio rerio OX=7955 GN=tob1 PE=2 SV=1
10	Q61471	8.06e-31	116	362	0.298	0.141	TOB1_MOUSE Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1 SV=2
11	Q14106	1.88e-30	115	344	0.292	0.145	TOB2_HUMAN Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 SV=2
12	Q9JM55	5.82e-30	113	345	0.292	0.145	TOB2_MOUSE Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2 SV=1
13	Q9VXJ9	1.61e-25	103	564	0.251	0.076	Q9VXJ9_DROME Transducer of ERBB2, isoform A OS=Drosophila melanogaster OX=7227 GN=Tob PE=3 SV=1
14	P50615	4.80e-24	96.3	252	0.275	0.187	BTG3_MOUSE Protein BTG3 OS=Mus musculus OX=10090 GN=Btg3 PE=2 SV=1
15	Q14201	2.24e-23	94.7	252	0.275	0.187	BTG3_HUMAN Protein BTG3 OS=Homo sapiens OX=9606 GN=BTG3 PE=1 SV=3
16	O88677	3.08e-23	94.4	252	0.269	0.183	BTG3_RAT Protein BTG3 OS=Rattus norvegicus OX=10116 GN=Btg3 PE=2 SV=1
17	O70552	4.13e-22	91.3	250	0.275	0.188	BTG4_MOUSE Protein BTG4 OS=Mus musculus OX=10090 GN=Btg4 PE=1 SV=2
18	Q9NY30	5.65e-20	85.1	223	0.240	0.184	BTG4_HUMAN Protein BTG4 OS=Homo sapiens OX=9606 GN=BTG4 PE=1 SV=1
19	Q54NU5	5.91e-09	56.2	423	0.158	0.064	BTG_DICDI BTG family protein OS=Dictyostelium discoideum OX=44689 GN=btg PE=3 SV=1
20	G5EDX7	7.80e-06	47.0	263	0.158	0.103	G5EDX7_CAEEL Anti-proliferative protein domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fog-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07742 BTG	7.2e-41	150.0	BTG family
2	PF12668 DUF3791	3.2e+02	12.7	Protein of unknown function (DUF3791)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000005143

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000011050	0.908	CCR4-NOT transcription complex, subunit 7
2	132908.ENSPVAP00000002141	0.904	CCR4-NOT transcription complex, subunit 8
3	132908.ENSPVAP00000017032	0.848	Protein arginine methyltransferase 1
4	132908.ENSPVAP00000015266	0.666	Protein arginine methyltransferase 8
5	132908.ENSPVAP00000005536	0.603	Chromatin assembly factor 1, subunit A (p150)
6	132908.ENSPVAP00000004018	0.574	CCR4-NOT transcription complex, subunit 1
7	132908.ENSPVAP00000016181	0.571	RCD1 required for cell differentiation1 homolog (S. pombe)
8	132908.ENSPVAP00000006674	0.569	CCR4-NOT transcription complex, subunit 2
9	132908.ENSPVAP00000015355	0.569	annotation not available
10	132908.ENSPVAP00000014468	0.561	Tousled-like kinase 2
11	132908.ENSPVAP00000014674	0.557	CCR4-NOT transcription complex, subunit 3
12	132908.ENSPVAP00000016711	0.554	Protein arginine methyltransferase 3
13	132908.ENSPVAP00000001072	0.553	Forkhead box O3
14	132908.ENSPVAP00000003927	0.553	CCR4-NOT transcription complex, subunit 10
15	132908.ENSPVAP00000015491	0.546	Tankyrase 1 binding protein 1, 182kDa
16	132908.ENSPVAP00000002797	0.538	CCR4-NOT transcription complex, subunit 11
17	132908.ENSPVAP00000010272	0.504	Protein arginine methyltransferase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.758	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0042127	0.965	regulation of cell population proliferation
GO:0032502	0.960	developmental process
GO:0032501	0.959	multicellular organismal process
GO:0071704	0.950	organic substance metabolic process
GO:0048518	0.935	positive regulation of biological process
GO:0044238	0.932	primary metabolic process
GO:0044237	0.932	cellular metabolic process
GO:0048523	0.928	negative regulation of cellular process
GO:0006807	0.881	nitrogen compound metabolic process
GO:0048522	0.875	positive regulation of cellular process
GO:0032259	0.864	methylation
GO:0008213	0.851	protein alkylation
GO:0008285	0.810	negative regulation of cell population proliferation
GO:0050896	0.808	response to stimulus
GO:0019222	0.804	regulation of metabolic process
GO:0060255	0.783	regulation of macromolecule metabolic process
GO:0051239	0.782	regulation of multicellular organismal process
GO:0050793	0.779	regulation of developmental process
GO:0045595	0.759	regulation of cell differentiation
GO:0044260	0.759	cellular macromolecule metabolic process
GO:2000026	0.756	regulation of multicellular organismal development
GO:0010468	0.700	regulation of gene expression
GO:0045597	0.607	positive regulation of cell differentiation
GO:0008283	0.596	cell population proliferation
GO:0048856	0.565	anatomical structure development
GO:0007275	0.549	multicellular organism development
GO:0031323	0.543	regulation of cellular metabolic process
GO:0051171	0.541	regulation of nitrogen compound metabolic process
GO:0080090	0.528	regulation of primary metabolic process
GO:0042221	0.444	response to chemical
GO:0030856	0.438	regulation of epithelial cell differentiation
GO:0045661	0.412	regulation of myoblast differentiation
GO:0048731	0.405	system development
GO:0009889	0.399	regulation of biosynthetic process
GO:0045601	0.385	regulation of endothelial cell differentiation
GO:0010556	0.375	regulation of macromolecule biosynthetic process
GO:0019219	0.349	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.340	regulation of RNA metabolic process
GO:0010605	0.337	negative regulation of macromolecule metabolic process
GO:0031326	0.334	regulation of cellular biosynthetic process
GO:0006950	0.318	response to stress
GO:0010941	0.315	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.985	cytoplasm
GO:0032991	0.305	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]