StarFunc result for job id P62330

User Input

>input (175 residues)
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3N3N1	0.962	0.962	1.838E-37	175	1.000	1.000	G3N3N1.pdb.gz	G3N3N1_BOVIN ADP-ribosylation factor 6 OS=Bos taurus OX=9913 GN=ARF6 PE=3 SV=1
2	AFDB:Q9U2S4	0.980	0.980	1.217E-35	175	0.880	0.880	Q9U2S4.pdb.gz	Q9U2S4_CAEEL ADP-ribosylation factor 6 OS=Caenorhabditis elegans OX=6239 GN=arf-6 PE=1 SV=1
3	PDB:6bbpA	0.943	0.321	8.315E-35	520	0.977	0.329	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
4	AFDB:Q9Y7Z2	0.966	0.919	2.162E-32	184	0.737	0.701	Q9Y7Z2.pdb.gz	ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arf6 PE=3 SV=1
5	PDB:3lvqE	0.926	0.388	3.351E-32	420	0.943	0.393	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
6	AFDB:Q7KQL3	0.963	0.932	4.689E-32	181	0.663	0.641	Q7KQL3.pdb.gz	ARF1_PLAF7 ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=ARF1 PE=1 SV=1
7	AFDB:Q5AND9	0.950	0.919	1.497E-31	181	0.697	0.674	Q5AND9.pdb.gz	Q5AND9_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARF2 PE=1 SV=1
8	AFDB:P61209	0.943	0.908	3.940E-31	182	0.691	0.665	P61209.pdb.gz	ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster OX=7227 GN=Arf1 PE=1 SV=2
9	AFDB:P84084	0.932	0.907	2.108E-30	180	0.640	0.622	P84084.pdb.gz	ARF5_MOUSE ADP-ribosylation factor 5 OS=Mus musculus OX=10090 GN=Arf5 PE=1 SV=2
10	AFDB:P40945	0.941	0.915	2.399E-30	180	0.646	0.628	P40945.pdb.gz	ARF2_DROME ADP-ribosylation factor 2 OS=Drosophila melanogaster OX=7227 GN=Arf102F PE=2 SV=2
11	AFDB:G5EFK4	0.938	0.913	8.170E-30	180	0.640	0.622	G5EFK4.pdb.gz	G5EFK4_CAEEL ADP-ribosylation factor OS=Caenorhabditis elegans OX=6239 GN=arf-3 PE=1 SV=1
12	AFDB:Q38D64	0.930	0.894	1.557E-29	182	0.640	0.615	Q38D64.pdb.gz	Q38D64_TRYB2 ADP-ribosylation factor OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4470 PE=3 SV=1
13	PDB:1uptG	0.906	0.932	1.461E-25	170	0.509	0.524	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
14	PDB:8d9rC	0.942	0.916	2.295E-25	180	0.680	0.661	8d9rC.pdb.gz	Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat.
15	PDB:3lrpA	0.766	0.743	8.337E-25	181	0.691	0.669	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
16	PDB:3aq4A	0.737	0.757	2.715E-23	170	0.646	0.665	3aq4A.pdb.gz	Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
17	PDB:1z6xA	0.754	0.754	6.280E-23	175	0.640	0.640	1z6xA.pdb.gz	Structure Of Human ADP-Ribosylation Factor 4
18	PDB:4zi2A	0.893	0.846	1.880E-22	185	0.451	0.427	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
19	PDB:2b6hA	0.735	0.751	2.139E-22	171	0.606	0.620	2b6hA.pdb.gz	Structure of human ADP-ribosylation factor 5
20	PDB:5uf8A	0.735	0.794	2.282E-22	161	0.663	0.720	5uf8A.pdb.gz	Crystal structure of the ARF family small GTPase ARF2 from Candida albicans in complex with GDP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3N3N1	1.78e-130	364	175	1.000	1.000	G3N3N1_BOVIN ADP-ribosylation factor 6 OS=Bos taurus OX=9913 GN=ARF6 PE=3 SV=1
2	P62330	1.78e-130	364	175	1.000	1.000	ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens OX=9606 GN=ARF6 PE=1 SV=2
3	P62331	1.78e-130	364	175	1.000	1.000	ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus OX=10090 GN=Arf6 PE=1 SV=2
4	P62332	1.78e-130	364	175	1.000	1.000	ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus OX=10116 GN=Arf6 PE=1 SV=2
5	P26990	5.27e-130	363	175	0.994	0.994	ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus OX=9031 GN=ARF6 PE=2 SV=3
6	Q6P2U5	1.70e-129	362	175	0.989	0.989	Q6P2U5_DANRE ADP-ribosylation factor 6 OS=Danio rerio OX=7955 GN=arf6b PE=1 SV=1
7	P40946	8.70e-126	352	175	0.966	0.966	ARF6_DROME ADP-ribosylation factor 6 OS=Drosophila melanogaster OX=7227 GN=Arf6 PE=1 SV=3
8	Q9U2S4	1.24e-116	329	175	0.880	0.880	Q9U2S4_CAEEL ADP-ribosylation factor 6 OS=Caenorhabditis elegans OX=6239 GN=arf-6 PE=1 SV=1
9	E2RHL4	1.51e-107	305	148	0.846	1.000	E2RHL4_CANLF ADP ribosylation factor 6 OS=Canis lupus familiaris OX=9615 GN=ARF6 PE=3 SV=2
10	Q9Y7Z2	1.19e-96	279	184	0.737	0.701	ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arf6 PE=3 SV=1
11	Q9M1P5	3.01e-95	275	181	0.709	0.685	Q9M1P5_ARATH ADP-ribosylation factor OS=Arabidopsis thaliana OX=3702 GN=ARFA1E PE=1 SV=1
12	P36397	3.29e-95	275	181	0.709	0.685	ARF1_ARATH ADP-ribosylation factor 1 OS=Arabidopsis thaliana OX=3702 GN=ARF1 PE=1 SV=2
13	Q6ID97	1.25e-94	274	181	0.703	0.680	Q6ID97_ARATH ADP-ribosylation factor OS=Arabidopsis thaliana OX=3702 GN=ARFA1F PE=2 SV=1
14	Q5B360	1.73e-94	273	185	0.720	0.681	Q5B360_EMENI ADP ribosylation factor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05020 PE=3 SV=1
15	Q5AND9	2.55e-94	273	181	0.703	0.680	Q5AND9_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARF2 PE=1 SV=1
16	P0DH91	5.32e-94	272	181	0.697	0.674	ARF2B_ARATH ADP-ribosylation factor 2-B OS=Arabidopsis thaliana OX=3702 GN=ARF2-B PE=2 SV=1
17	Q9LQC8	5.32e-94	272	181	0.697	0.674	ARF2A_ARATH ADP-ribosylation factor 2-A OS=Arabidopsis thaliana OX=3702 GN=ARF2-A PE=2 SV=2
18	Q9LYJ3	1.32e-93	271	188	0.697	0.649	Q9LYJ3_ARATH ADP-ribosylation factor OS=Arabidopsis thaliana OX=3702 GN=ARFA1B PE=1 SV=1
19	P51823	2.24e-93	271	181	0.691	0.669	ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica OX=39947 GN=ARF PE=2 SV=2
20	Q803D1	2.02e-92	268	180	0.697	0.678	Q803D1_DANRE ADP-ribosylation factor OS=Danio rerio OX=7955 GN=wu:fb33e02 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	18	16.1	6-phosphofructo-2-kinase
2	PF00025 Arf	4.8e-75	262.3	ADP-ribosylation factor family
3	PF19993 DO-GTPase2	1.7e+02	13.4	Double-GTPase 2
4	PF00503 G-alpha	4.7e-09	47.5	G-protein alpha subunit
5	PF04670 Gtr1_RagA	5.7e-06	37.4	Gtr1/RagA G protein conserved region
6	PF01926 MMR_HSR1	0.42	22.1	50S ribosome-binding GTPase
7	PF00071 Ras	8.2e-11	53.3	Ras family
8	PF08477 Roc	2.3e-11	55.3	Ras of Complex, Roc, domain of DAPkinase
9	PF09388 SpoOE-like	92	14.3	Spo0E like sporulation regulatory protein
10	PF09439 SRPRB	1.2e-09	49.3	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9685.ENSFCAP00000023064

Rank	PPI partner	STRING score	Description
1	9685.ENSFCAP00000017689	0.990	Cytohesin 3
2	9685.ENSFCAP00000009549	0.977	Kinesin-like protein
3	9685.ENSFCAP00000007979	0.975	Cytohesin 1
4	9685.ENSFCAP00000013464	0.969	Golgi-associated, gamma adaptin ear containing, ARF binding protein 3
5	9685.ENSFCAP00000001958	0.968	Uncharacterized protein
6	9685.ENSFCAP00000006602	0.967	Phospholipase D1, phosphatidylcholine-specific
7	9685.ENSFCAP00000007698	0.964	RAB11 family interacting protein 3 (class II)
8	9685.ENSFCAP00000006620	0.963	Phosphatidylinositol-4-phosphate 5-kinase, type I, gamma
9	9685.ENSFCAP00000005162	0.958	Phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
10	9685.ENSFCAP00000005981	0.954	ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
11	9685.ENSFCAP00000008168	0.935	Phosphatidylinositol-4-phosphate 5-kinase, type I, beta
12	9685.ENSFCAP00000022739	0.935	ADP-ribosylation factor 1
13	9685.ENSFCAP00000006264	0.932	Sperm associated antigen 9
14	9685.ENSFCAP00000021948	0.926	Uncharacterized protein
15	9685.ENSFCAP00000012756	0.923	Cytohesin 4
16	9685.ENSFCAP00000010884	0.915	Mitogen-activated protein kinase 8 interacting protein 3
17	9685.ENSFCAP00000012900	0.909	IQ motif and Sec7 domain 1
18	9685.ENSFCAP00000002534	0.904	GIT ArfGAP 1
19	9685.ENSFCAP00000003938	0.903	Golgi-associated, gamma adaptin ear containing, ARF binding protein 1
20	9685.ENSFCAP00000001891	0.893	Exocyst complex component 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140677	0.998	molecular function activator activity
GO:0030234	0.998	enzyme regulator activity
GO:0016817	0.996	hydrolase activity, acting on acid anhydrides
GO:0005525	0.996	GTP binding
GO:0016818	0.976	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003924	0.971	GTPase activity
GO:0008047	0.866	enzyme activator activity
GO:0031681	0.639	G-protein beta-subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.983	biological regulation
GO:0050794	0.971	regulation of cellular process
GO:0006810	0.954	transport
GO:0032501	0.932	multicellular organismal process
GO:0048856	0.929	anatomical structure development
GO:0051641	0.927	cellular localization
GO:0007275	0.897	multicellular organism development
GO:0061008	0.888	hepaticobiliary system development
GO:0032879	0.852	regulation of localization
GO:0051130	0.851	positive regulation of cellular component organization
GO:0048732	0.835	gland development
GO:0016192	0.820	vesicle-mediated transport
GO:0071840	0.790	cellular component organization or biogenesis
GO:1903829	0.771	positive regulation of protein localization
GO:0050896	0.764	response to stimulus
GO:1904375	0.744	regulation of protein localization to cell periphery
GO:0048519	0.725	negative regulation of biological process
GO:1905475	0.717	regulation of protein localization to membrane
GO:1903076	0.697	regulation of protein localization to plasma membrane
GO:0016043	0.691	cellular component organization
GO:0031344	0.674	regulation of cell projection organization
GO:0065008	0.671	regulation of biological quality
GO:0035622	0.661	intrahepatic bile duct development
GO:1905477	0.660	positive regulation of protein localization to membrane
GO:0002011	0.657	morphogenesis of an epithelial sheet
GO:0071705	0.646	nitrogen compound transport
GO:0051049	0.643	regulation of transport
GO:0051649	0.619	establishment of localization in cell
GO:0007369	0.617	gastrulation
GO:1903078	0.617	positive regulation of protein localization to plasma membrane
GO:0001702	0.612	gastrulation with mouth forming second
GO:0008104	0.611	protein localization
GO:0050793	0.599	regulation of developmental process
GO:0071702	0.541	organic substance transport
GO:0007154	0.533	cell communication
GO:0051716	0.530	cellular response to stimulus
GO:0023052	0.518	signaling
GO:0019222	0.505	regulation of metabolic process
GO:0044087	0.471	regulation of cellular component biogenesis
GO:0048523	0.433	negative regulation of cellular process
GO:0007165	0.429	signal transduction
GO:0060191	0.330	regulation of lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005886	0.990	plasma membrane
GO:0031982	0.960	vesicle
GO:0031410	0.857	cytoplasmic vesicle
GO:0098590	0.529	plasma membrane region
GO:0120025	0.518	plasma membrane bounded cell projection
GO:0005768	0.500	endosome
GO:0030054	0.424	cell junction
GO:0098588	0.318	bounding membrane of organelle
GO:0005829	0.316	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.-.-	0.996	Acting on acid anhydrides.
EC:3.6.1.-	0.976	In phosphorus-containing anhydrides.
RHEA:19669	0.971	GTP + H2O = GDP + H(+) + phosphate

[back to server]