StarFunc result for job id P62380

User Input

>input (186 residues)
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62340	1.000	1.000	1.325E-38	186	1.000	1.000	P62340.pdb.gz	TBPL1_MOUSE TATA box-binding protein-like 1 OS=Mus musculus OX=10090 GN=Tbpl1 PE=1 SV=1
2	AFDB:Q5U385	0.990	0.990	1.761E-34	186	0.785	0.785	Q5U385.pdb.gz	TBPL1_DANRE TATA box-binding protein-like 1 OS=Danio rerio OX=7955 GN=tbpl1 PE=2 SV=1
3	AFDB:Q07DP5	0.968	0.107	4.290E-28	1715	0.554	0.060	Q07DP5.pdb.gz	Q07DP5_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
4	AFDB:P20226	0.926	0.519	1.158E-22	339	0.392	0.215	P20226.pdb.gz	TBP_HUMAN TATA-box-binding protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=2
5	AFDB:P27633	0.928	0.589	1.840E-22	297	0.392	0.246	P27633.pdb.gz	TBP_XENLA TATA-box-binding protein OS=Xenopus laevis OX=8355 GN=tbp PE=1 SV=1
6	AFDB:Q6SJ96	0.929	0.470	1.840E-22	375	0.387	0.192	Q6SJ96.pdb.gz	TBPL2_HUMAN TATA box-binding protein-like 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1
7	AFDB:Q8W0W4	0.914	0.840	2.924E-22	203	0.409	0.374	Q8W0W4.pdb.gz	TBP2_ORYSJ TATA-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=TBP2 PE=1 SV=2
8	AFDB:P20227	0.929	0.499	5.217E-22	353	0.371	0.195	P20227.pdb.gz	TBP_DROME TATA-box-binding protein OS=Drosophila melanogaster OX=7227 GN=Tbp PE=1 SV=1
9	AFDB:P53360	0.929	0.552	6.577E-22	318	0.392	0.230	P53360.pdb.gz	TBP_MESAU TATA-box-binding protein OS=Mesocricetus auratus OX=10036 GN=TBP PE=2 SV=1
10	AFDB:Q28DH2	0.932	0.546	1.661E-21	322	0.376	0.217	Q28DH2.pdb.gz	TBPL2_XENTR TATA box-binding protein-like 2 OS=Xenopus tropicalis OX=8364 GN=tbpl2 PE=2 SV=1
11	PDB:1vokA	0.924	0.896	3.632E-21	192	0.382	0.370	1vokA.pdb.gz
12	PDB:7o4iO	0.905	0.930	1.156E-20	181	0.360	0.370	7o4iO.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:3ociB	0.901	0.931	2.454E-20	180	0.349	0.361	3ociB.pdb.gz
14	PDB:5iy6P	0.921	0.926	3.322E-19	185	0.387	0.389	5iy6P.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
15	PDB:1wsvA	0.362	0.229	6.739E-5	371	0.124	0.062	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
16	PDB:4pabB	0.401	0.134	1.516E-4	824	0.124	0.028	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
17	PDB:1vloA	0.334	0.214	8.125E-4	364	0.097	0.049	1vloA.pdb.gz
18	PDB:2f1fA	0.210	0.228	1.038E-2	163	0.108	0.123	2f1fA.pdb.gz
19	PDB:2j0wA	0.271	0.153	1.386E-2	447	0.113	0.047	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.
20	PDB:6bm7E	0.262	0.186	1.852E-2	291	0.113	0.072	6bm7E.pdb.gz	Species-Selective Pyrimidineamine Inhibitors of Trypanosoma brucei S-Adenosylmethionine Decarboxylase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62340	6.29e-138	384	186	1.000	1.000	TBPL1_MOUSE TATA box-binding protein-like 1 OS=Mus musculus OX=10090 GN=Tbpl1 PE=1 SV=1
2	P62380	6.29e-138	384	186	1.000	1.000	TBPL1_HUMAN TATA box-binding protein-like 1 OS=Homo sapiens OX=9606 GN=TBPL1 PE=1 SV=1
3	Q9W6Z2	7.56e-127	356	186	0.925	0.925	TBPL1_XENLA TATA box-binding protein-like 1 OS=Xenopus laevis OX=8355 GN=tbpl1 PE=2 SV=1
4	Q5U385	9.87e-109	310	186	0.785	0.785	TBPL1_DANRE TATA box-binding protein-like 1 OS=Danio rerio OX=7955 GN=tbpl1 PE=2 SV=1
5	Q7KA83	5.01e-68	218	537	0.554	0.192	Q7KA83_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
6	Q8T052	1.85e-67	218	632	0.554	0.163	Q8T052_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
7	Q9XZD9	1.89e-67	218	632	0.554	0.163	Q9XZD9_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
8	M9PHD8	1.69e-65	219	1714	0.554	0.060	M9PHD8_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=3 SV=1
9	Q07DP5	1.69e-65	219	1715	0.554	0.060	Q07DP5_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
10	Q8W0W4	1.88e-43	145	203	0.392	0.360	TBP2_ORYSJ TATA-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=TBP2 PE=1 SV=2
11	P28148	1.37e-41	140	200	0.387	0.360	TBP2_ARATH TATA-box-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=TBP2 PE=1 SV=1
12	P28147	3.11e-41	139	200	0.382	0.355	TBP1_ARATH TATA-box-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=TBP1 PE=1 SV=1
13	Q32MN6	2.67e-40	140	288	0.392	0.253	Q32MN6_HUMAN TBP protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=1
14	P27633	3.77e-40	139	297	0.392	0.246	TBP_XENLA TATA-box-binding protein OS=Xenopus laevis OX=8355 GN=tbp PE=1 SV=1
15	Q28GG8	3.77e-40	139	297	0.392	0.246	TBP_XENTR TATA-box-binding protein OS=Xenopus tropicalis OX=8364 GN=tbp PE=2 SV=1
16	Q1JPY4	4.27e-40	140	312	0.382	0.228	TBPL2_DANRE TATA box-binding protein-like 2 OS=Danio rerio OX=7955 GN=tbpl2 PE=1 SV=1
17	P29037	4.39e-40	140	316	0.392	0.231	TBP_MOUSE TATA-box-binding protein OS=Mus musculus OX=10090 GN=Tbp PE=1 SV=1
18	Q66HB1	4.94e-40	140	318	0.392	0.230	Q66HB1_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=3 SV=1
19	P53360	5.05e-40	140	318	0.392	0.230	TBP_MESAU TATA-box-binding protein OS=Mesocricetus auratus OX=10036 GN=TBP PE=2 SV=1
20	Q28DH2	5.07e-40	140	322	0.376	0.217	TBPL2_XENTR TATA box-binding protein-like 2 OS=Xenopus tropicalis OX=8364 GN=tbpl2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11858 DUF3378	6	18.4	Domain of unknown function (DUF3378)
2	PF00352 TBP	2.8e-39	144.2	Transcription factor TFIID (or TATA-binding protein, TBP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008820320.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008834067.1	0.993	Transcription initiation factor IIA subunit 1 isoform X1
2	1026970.XP_008826512.1	0.991	General transcription factor IIB
3	1026970.XP_008823343.1	0.988	TATA-box binding protein associated factor 3
4	1026970.XP_008821262.1	0.975	General transcription factor IIA subunit 1 like
5	1026970.XP_008837755.1	0.965	TATA box-binding protein-like protein 2
6	1026970.XP_008841626.1	0.965	TATA-box-binding protein
7	1026970.XP_008853785.1	0.940	TATA-box binding protein associated factor 1
8	1026970.XP_008835639.1	0.936	TATA-box binding protein associated factor 10
9	1026970.XP_008836201.1	0.936	TATA-box binding protein associated factor 2
10	1026970.XP_008838341.1	0.936	TATA-box binding protein associated factor 11
11	1026970.XP_008848631.1	0.936	TATA-box binding protein associated factor 13
12	1026970.XP_008836704.1	0.935	B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB
13	1026970.XP_008821476.1	0.926	TATA-box binding protein associated factor 8
14	1026970.XP_008835096.1	0.920	Transcription initiation factor IIA subunit 2
15	1026970.XP_008845860.1	0.896	TATA-box binding protein associated factor 4b
16	1026970.XP_008828881.1	0.892	ERCC excision repair 3, TFIIH core complex helicase subunit
17	1026970.XP_008835131.1	0.891	General transcription factor IIF subunit 1 isoform X1
18	1026970.XP_008833112.1	0.881	DNA-directed RNA polymerase II subunit RPB3
19	1026970.XP_008825937.1	0.877	General transcription factor IIF subunit 2
20	1026970.XP_008827251.1	0.877	SPT3 homolog, SAGA and STAGA complex component

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016251	0.997	RNA polymerase II general transcription initiation factor activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0001046	0.986	core promoter sequence-specific DNA binding
GO:0000977	0.942	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000979	0.824	RNA polymerase II core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.995	metabolic process
GO:0034654	0.993	nucleobase-containing compound biosynthetic process
GO:0006351	0.955	DNA-templated transcription
GO:0006366	0.919	transcription by RNA polymerase II
GO:0032502	0.561	developmental process
GO:0032501	0.559	multicellular organismal process
GO:0048856	0.520	anatomical structure development
GO:0065007	0.328	biological regulation
GO:0050789	0.301	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.996	nucleoplasm
GO:0005667	0.990	transcription regulator complex
GO:0140513	0.961	nuclear protein-containing complex
GO:0140535	0.959	intracellular protein-containing complex
GO:0061695	0.957	transferase complex, transferring phosphorus-containing groups
GO:0055029	0.939	nuclear DNA-directed RNA polymerase complex
GO:0005737	0.928	cytoplasm
GO:0090575	0.919	RNA polymerase II transcription regulator complex
GO:0016591	0.911	RNA polymerase II, holoenzyme
GO:0001673	0.545	male germ cell nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]