StarFunc result for job id P62487

User Input

>input (172 residues)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62487	1.000	1.000	1.208E-32	172	1.000	1.000	P62487.pdb.gz	RPB7_HUMAN DNA-directed RNA polymerase II subunit RPB7 OS=Homo sapiens OX=9606 GN=POLR2G PE=1 SV=1
2	PDB:2c35B	0.955	0.961	1.620E-29	171	0.994	1.000	2c35B.pdb.gz
3	AFDB:Q9VFB5	0.992	0.986	2.723E-28	173	0.814	0.809	Q9VFB5.pdb.gz	Q9VFB5_DROME IP02321p OS=Drosophila melanogaster OX=7227 GN=Polr2G PE=1 SV=2
4	AFDB:P38421	0.974	0.952	6.468E-24	176	0.535	0.523	P38421.pdb.gz	NRPB7_ARATH DNA-directed RNA polymerase II subunit 7 OS=Arabidopsis thaliana OX=3702 GN=NRPB7 PE=1 SV=1
5	AFDB:Q54P04	0.984	0.984	4.751E-23	172	0.512	0.512	Q54P04.pdb.gz	RPB7_DICDI DNA-directed RNA polymerase II subunit rpb7 OS=Dictyostelium discoideum OX=44689 GN=polr2g PE=3 SV=1
6	AFDB:O14459	0.960	0.960	1.589E-22	172	0.506	0.506	O14459.pdb.gz	RPB7_SCHPO DNA-directed RNA polymerase II subunit rpb7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb7 PE=1 SV=1
7	AFDB:Q5A8Y7	0.956	0.950	5.899E-22	173	0.494	0.491	Q5A8Y7.pdb.gz	Q5A8Y7_CANAL DNA-directed RNA polymerase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPB7 PE=3 SV=1
8	AFDB:P34087	0.952	0.958	9.460E-22	171	0.424	0.427	P34087.pdb.gz	RPB7_YEAST DNA-directed RNA polymerase II subunit RPB7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB7 PE=1 SV=1
9	PDB:3h0gG	0.933	0.944	1.077E-19	170	0.488	0.494	3h0gG.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
10	PDB:7o4kG	0.927	0.932	1.727E-19	171	0.424	0.427	7o4kG.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
11	AFDB:A6QRA1	0.903	0.874	1.845E-15	178	0.291	0.281	A6QRA1.pdb.gz	NRPE7_ARATH DNA-directed RNA polymerase V subunit 7 OS=Arabidopsis thaliana OX=3702 GN=NRPE7 PE=1 SV=1
12	PDB:1y14B	0.824	0.916	2.841E-15	154	0.395	0.442	1y14B.pdb.gz
13	AFDB:Q8LE42	0.903	0.894	4.054E-15	174	0.285	0.282	Q8LE42.pdb.gz	NRPD7_ARATH DNA-directed RNA polymerase IV subunit 7 OS=Arabidopsis thaliana OX=3702 GN=NRPD7 PE=1 SV=1
14	AFDB:Q381Y8	0.887	0.807	1.294E-13	190	0.285	0.258	Q381Y8.pdb.gz	Q381Y8_TRYB2 RNA polymerase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6090 PE=1 SV=1
15	PDB:3ayhB	0.777	0.737	1.533E-13	183	0.262	0.246	3ayhB.pdb.gz
16	PDB:7oqyE	0.849	0.806	1.473E-11	182	0.215	0.203	7oqyE.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
17	PDB:2pmzE	0.864	0.846	4.208E-11	176	0.221	0.216	2pmzE.pdb.gz	The X-ray crystal structure of RNA polymerase from Archaea
18	PDB:2ckzD	0.729	0.714	2.141E-10	176	0.192	0.188	2ckzD.pdb.gz
19	PDB:7a6hG	0.789	0.727	6.445E-10	189	0.209	0.190	7a6hG.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
20	PDB:5fj8G	0.709	0.647	3.456E-9	191	0.203	0.183	5fj8G.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62487	2.78e-126	353	172	1.000	1.000	RPB7_HUMAN DNA-directed RNA polymerase II subunit RPB7 OS=Homo sapiens OX=9606 GN=POLR2G PE=1 SV=1
2	P62488	2.78e-126	353	172	1.000	1.000	RPB7_MOUSE DNA-directed RNA polymerase II subunit RPB7 OS=Mus musculus OX=10090 GN=Polr2g PE=1 SV=1
3	P62489	2.78e-126	353	172	1.000	1.000	RPB7_RAT DNA-directed RNA polymerase II subunit RPB7 OS=Rattus norvegicus OX=10116 GN=Polr2g PE=2 SV=1
4	Q9VFB5	1.15e-104	299	173	0.814	0.809	Q9VFB5_DROME IP02321p OS=Drosophila melanogaster OX=7227 GN=Polr2G PE=1 SV=2
5	Q54P04	8.61e-67	203	172	0.512	0.512	RPB7_DICDI DNA-directed RNA polymerase II subunit rpb7 OS=Dictyostelium discoideum OX=44689 GN=polr2g PE=3 SV=1
6	P38421	7.33e-66	201	176	0.535	0.523	NRPB7_ARATH DNA-directed RNA polymerase II subunit 7 OS=Arabidopsis thaliana OX=3702 GN=NRPB7 PE=1 SV=1
7	Q5A8Y7	8.22e-60	185	173	0.506	0.503	Q5A8Y7_CANAL DNA-directed RNA polymerase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPB7 PE=3 SV=1
8	O14459	3.41e-59	184	172	0.512	0.512	RPB7_SCHPO DNA-directed RNA polymerase II subunit rpb7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb7 PE=1 SV=1
9	P34087	3.91e-45	148	171	0.430	0.433	RPB7_YEAST DNA-directed RNA polymerase II subunit RPB7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB7 PE=1 SV=1
10	A6QRA1	1.81e-16	74.7	178	0.279	0.270	NRPE7_ARATH DNA-directed RNA polymerase V subunit 7 OS=Arabidopsis thaliana OX=3702 GN=NRPE7 PE=1 SV=1
11	Q381Y8	4.18e-14	68.9	190	0.267	0.242	Q381Y8_TRYB2 RNA polymerase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6090 PE=1 SV=1
12	Q8LE42	3.21e-13	66.2	174	0.256	0.253	NRPD7_ARATH DNA-directed RNA polymerase IV subunit 7 OS=Arabidopsis thaliana OX=3702 GN=NRPD7 PE=1 SV=1
13	Q9M9Y6	3.67e-09	55.8	204	0.285	0.240	Q9M9Y6_ARATH DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=NRPC7 PE=1 SV=1
14	O94285	1.92e-07	50.8	203	0.238	0.202	RPC8_SCHPO DNA-directed RNA polymerase III subunit rpc8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc25 PE=1 SV=1
15	P39466	1.58e-06	48.1	183	0.227	0.213	RPO7_SULAC DNA-directed RNA polymerase subunit Rpo7 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo7 PE=1 SV=2
16	P35718	1.76e-04	42.7	212	0.209	0.170	RPC8_YEAST DNA-directed RNA polymerase III subunit RPC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC25 PE=1 SV=1
17	Q6DGK6	0.010	37.4	214	0.192	0.154	Q6DGK6_DANRE DNA-directed RNA polymerase subunit OS=Danio rerio OX=7955 GN=zgc:92878 PE=2 SV=1
18	Q980A3	0.012	37.0	180	0.198	0.189	RPO7_SACS2 DNA-directed RNA polymerase subunit Rpo7 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo7 PE=1 SV=1
19	Q9Y535	0.018	36.6	204	0.174	0.147	RPC8_HUMAN DNA-directed RNA polymerase III subunit RPC8 OS=Homo sapiens OX=9606 GN=POLR3H PE=1 SV=1
20	B8YB57	0.025	36.2	180	0.203	0.194	RPO7_SACSH DNA-directed RNA polymerase subunit Rpo7 OS=Saccharolobus shibatae OX=2286 GN=rpo7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00575 S1	1.8e-17	74.8	S1 RNA binding domain
2	PF03876 SHS2_Rpb7-N	2.7e-07	42.1	SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008835730.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008831507.1	0.999	DNA-directed RNA polymerase II subunit RPB2
2	1026970.XP_008833112.1	0.999	DNA-directed RNA polymerase II subunit RPB3
3	1026970.XP_008835404.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
4	1026970.XP_008849500.1	0.999	RNA polymerase II subunit F
5	1026970.XP_008852647.1	0.999	RNA polymerase II subunit L
6	1026970.XP_008854027.1	0.999	RNA polymerase II subunit A
7	1026970.XP_008820224.1	0.998	DNA-directed RNA polymerase II subunit RPB4
8	1026970.XP_008826292.1	0.998	DNA-directed RNA polymerase II subunit RPB9 isoform X1
9	1026970.XP_008829529.1	0.998	RNA polymerase II subunit H
10	1026970.XP_008829775.1	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC4
11	1026970.XP_008830505.1	0.997	RNA polymerase II subunit J
12	1026970.XP_008825937.1	0.984	General transcription factor IIF subunit 2
13	1026970.XP_008852185.1	0.984	Transcription elongation factor SPT5 isoform X1
14	1026970.XP_008840915.1	0.980	Transcription elongation factor SPT4 isoform X1
15	1026970.XP_008826512.1	0.977	General transcription factor IIB
16	1026970.XP_008821917.1	0.975	DNA-directed RNA polymerases I, II, and III subunit RPABC5-like
17	1026970.XP_008826715.1	0.974	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
18	1026970.XP_008827988.1	0.974	LEO1 homolog, Paf1/RNA polymerase II complex component
19	1026970.XP_008836748.1	0.973	UBX domain-containing protein 7
20	1026970.XP_008825052.1	0.969	Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0034062	0.781	5'-3' RNA polymerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0010467	0.981	gene expression
GO:0006139	0.979	nucleobase-containing compound metabolic process
GO:0016070	0.966	RNA metabolic process
GO:1901576	0.965	organic substance biosynthetic process
GO:0044249	0.956	cellular biosynthetic process
GO:0044271	0.937	cellular nitrogen compound biosynthetic process
GO:0097659	0.932	nucleic acid-templated transcription
GO:0006351	0.914	DNA-templated transcription
GO:0006366	0.826	transcription by RNA polymerase II
GO:0008219	0.785	cell death
GO:0006915	0.696	apoptotic process
GO:0065007	0.444	biological regulation
GO:0050789	0.372	regulation of biological process
GO:0050794	0.334	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1902494	0.995	catalytic complex
GO:1990234	0.994	transferase complex
GO:0140535	0.992	intracellular protein-containing complex
GO:0140513	0.990	nuclear protein-containing complex
GO:0061695	0.958	transferase complex, transferring phosphorus-containing groups
GO:0000428	0.947	DNA-directed RNA polymerase complex
GO:0055029	0.941	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.828	RNA polymerase II, holoenzyme
GO:0005665	0.765	RNA polymerase II, core complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21248	0.781	a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1)

[back to server]