StarFunc result for job id P62495

User Input

>input (437 residues)
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTAS
NIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPI
NTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKH
GRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSD
MFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGK
YCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDK
ETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QI78	0.912	0.884	2.066E-82	452	0.970	0.938	A0A2R8QI78.pdb.gz
2	AFDB:Q9VPH7	0.686	0.685	2.959E-75	438	0.851	0.849	Q9VPH7.pdb.gz	ERF1_DROME Eukaryotic peptide chain release factor subunit 1 OS=Drosophila melanogaster OX=7227 GN=eRF1 PE=1 SV=2
3	AFDB:D2K759	0.973	0.977	3.173E-73	435	0.728	0.731	D2K759.pdb.gz	ERF1Y_BRAOB Eukaryotic peptide chain release factor subunit 1-2 OS=Brassica oleracea var. botrytis OX=3715 GN=ERF1-2 PE=1 SV=1
4	AFDB:Q39097	0.957	0.959	9.171E-72	436	0.705	0.706	Q39097.pdb.gz	ERF1X_ARATH Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana OX=3702 GN=ERF1-1 PE=1 SV=2
5	AFDB:C8V9C7	0.933	0.937	4.275E-71	435	0.737	0.740	C8V9C7.pdb.gz	C8V9C7_EMENI ERF1_PODAN Eukaryotic peptide chain release factor subunit 1 (ERF1) (Eukaryotic release factor 1)Eukaryotic polypeptide releasing factor OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08853 PE=3 SV=1
6	AFDB:P12385	0.666	0.666	1.325E-67	437	0.675	0.675	P12385.pdb.gz	ERF1_YEAST Eukaryotic peptide chain release factor subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUP45 PE=1 SV=2
7	AFDB:P79063	0.933	0.942	3.300E-67	433	0.641	0.647	P79063.pdb.gz	ERF1_SCHPO Eukaryotic peptide chain release factor subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sup45 PE=1 SV=1
8	PDB:4d61h	0.617	0.619	3.258E-63	436	0.986	0.989	4d61h.pdb.gz	Cryo-Em of Ribosomal 80S Complexes with Termination Factors Reveals the Translocated Cricket Paralysis Virus Ires.
9	PDB:1dt9A	0.741	0.806	2.214E-61	398	0.897	0.985	1dt9A.pdb.gz
10	AFDB:Q9NAX8	0.654	0.634	3.553E-60	452	0.551	0.533	Q9NAX8.pdb.gz	ERF1_TRYBB Eukaryotic peptide chain release factor subunit 1 OS=Trypanosoma brucei brucei OX=5702 GN=ERF1 PE=3 SV=1
11	PDB:4crnX	0.546	0.563	1.197E-46	421	0.652	0.677	4crnX.pdb.gz	Cryoelectron Microscopic Structures of Eukaryotic Translation Termination Complexes Containing Erf1-Erf3 or Erf1-Abce1.
12	PDB:3e1yC	0.586	0.773	1.426E-41	318	0.714	0.981	3e1yC.pdb.gz	Structural insights into eRF3 and stop codon recognition by eRF1
13	AFDB:Q9YAF1	0.462	0.533	9.146E-33	373	0.254	0.298	Q9YAF1.pdb.gz	RF1_AERPE Peptide chain release factor subunit 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=prf1 PE=1 SV=2
14	PDB:3e20B	0.515	0.838	4.556E-29	261	0.375	0.628	3e20B.pdb.gz
15	PDB:3vmfB	0.345	0.409	1.134E-28	351	0.238	0.296	3vmfB.pdb.gz	Structural basis for translation termination by archaeal RF1 and GTP-bound EF1alpha complex
16	AFDB:P9WL63	0.437	0.499	3.987E-16	374	0.156	0.182	P9WL63.pdb.gz	Y2629_MYCTU Uncharacterized protein Rv2629 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2629 PE=1 SV=1
17	PDB:3wxmB	0.254	0.299	1.362E-13	357	0.126	0.154	3wxmB.pdb.gz	Structural basis for mRNA surveillance by archaeal Pelota and GTP-bound EF1 alpha complex
18	PDB:5lzwii	0.259	0.298	4.261E-13	372	0.126	0.148	5lzwii.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
19	PDB:3j16A	0.370	0.409	6.212E-12	386	0.124	0.140	3j16A.pdb.gz	Structural basis of highly conserved ribosome recycling in eukaryotes and archaea.
20	PDB:3e20H	0.251	0.614	5.740E-11	175	0.169	0.423	3e20H.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C8V9C7	0.0	681	435	0.739	0.743	C8V9C7_EMENI ERF1_PODAN Eukaryotic peptide chain release factor subunit 1 (ERF1) (Eukaryotic release factor 1)Eukaryotic polypeptide releasing factor OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08853 PE=3 SV=1
2	D2K759	0.0	649	435	0.723	0.726	ERF1Y_BRAOB Eukaryotic peptide chain release factor subunit 1-2 OS=Brassica oleracea var. botrytis OX=3715 GN=ERF1-2 PE=1 SV=1
3	P12385	0.0	619	437	0.668	0.668	ERF1_YEAST Eukaryotic peptide chain release factor subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUP45 PE=1 SV=2
4	P35614	0.0	660	435	0.737	0.740	ERF1Z_ARATH Eukaryotic peptide chain release factor subunit 1-3 OS=Arabidopsis thaliana OX=3702 GN=ERF1-3 PE=1 SV=1
5	P62495	0.0	897	437	1.000	1.000	ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 PE=1 SV=3
6	P79063	0.0	578	433	0.648	0.654	ERF1_SCHPO Eukaryotic peptide chain release factor subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sup45 PE=1 SV=1
7	Q39097	0.0	642	436	0.705	0.706	ERF1X_ARATH Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana OX=3702 GN=ERF1-1 PE=1 SV=2
8	Q803E5	0.0	867	442	0.973	0.962	Q803E5_DANRE Eukaryotic peptide chain release factor subunit 1 OS=Danio rerio OX=7955 GN=etf1 PE=1 SV=1
9	Q9LPV8	0.0	652	434	0.719	0.724	ERF1Y_ARATH Eukaryotic peptide chain release factor subunit 1-2 OS=Arabidopsis thaliana OX=3702 GN=ERF1-2 PE=1 SV=1
10	Q9VPH7	0.0	771	438	0.856	0.854	ERF1_DROME Eukaryotic peptide chain release factor subunit 1 OS=Drosophila melanogaster OX=7227 GN=eRF1 PE=1 SV=2
11	Q9NAX8	7.77e-177	503	452	0.558	0.540	ERF1_TRYBB Eukaryotic peptide chain release factor subunit 1 OS=Trypanosoma brucei brucei OX=5702 GN=ERF1 PE=3 SV=1
12	Q97W96	5.67e-46	164	369	0.279	0.331	RF1_SACS2 Peptide chain release factor subunit 1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=prf1 PE=1 SV=1
13	Q9YAF1	5.41e-45	162	373	0.259	0.303	RF1_AERPE Peptide chain release factor subunit 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=prf1 PE=1 SV=2
14	Q9USL5	0.006	41.2	390	0.037	0.041	DOM34_SCHPO Protein dom34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dom34 PE=1 SV=1
15	P62009	0.010	38.5	123	0.064	0.228	RL7A_PYRHO Large ribosomal subunit protein eL8 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=rpl7ae PE=1 SV=1
16	A0A1D8PSD0	0.031	38.9	393	0.055	0.061	A0A1D8PSD0_CANAL Protein DOM34 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DOM34 PE=3 SV=1
17	Q8MT23	0.38	33.5	111	0.030	0.117	Q8MT23_DROME Large ribosomal subunit protein eL30 OS=Drosophila melanogaster OX=7227 GN=RpL30 PE=2 SV=1
18	Q9VJ19	1.1	32.3	111	0.027	0.108	Q9VJ19_DROME Large ribosomal subunit protein eL30 OS=Drosophila melanogaster OX=7227 GN=RpL30 PE=1 SV=1
19	Q9LXZ5	3.3	32.3	381	0.066	0.076	SNAA1_ARATH Alpha-soluble NSF attachment protein 1 OS=Arabidopsis thaliana OX=3702 GN=ASNAP1 PE=1 SV=1
20	P14120	4.4	30.4	105	0.025	0.105	RL30_YEAST Large ribosomal subunit protein eL30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL30 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18859 acVLRF1	0.00041	32.0	Actinobacteria/chloroflexi VLRF1 release factor
2	PF18854 baeRF_family10	0.0029	29.3	Bacterial archaeo-eukaryotic release factor family 10
3	PF16107 DUF4825	2.6e+02	13.1	Domain of unknown function (DUF4825)
4	PF03463 eRF1_1	1.6e-09	49.3	eRF1 domain 1
5	PF03464 eRF1_2	5.5e-43	157.9	eRF1 domain 2
6	PF03465 eRF1_3	1.7e-35	133.3	eRF1 domain 3
7	PF01248 Ribosomal_L7Ae	40	15.3	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008832511.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008828136.1	0.998	G1 to S phase transition 1
2	1026970.XP_008825705.1	0.992	ATP-binding cassette sub-family E member 1
3	1026970.XP_008845828.1	0.992	G1 to S phase transition 2
4	1026970.XP_008825151.1	0.961	SMG1, nonsense mediated mRNA decay associated PI3K related kinase
5	1026970.XP_008846918.1	0.920	Proliferation-associated protein 2G4
6	1026970.XP_008854454.1	0.919	Ribosomal protein S2
7	1026970.XP_008831299.1	0.894	40S ribosomal protein S20
8	1026970.XP_008822751.1	0.889	UPF1, RNA helicase and ATPase
9	1026970.XP_008834253.1	0.889	N-6 adenine-specific DNA methyltransferase 1 (putative)
10	1026970.XP_008834569.1	0.889	60S ribosomal protein L4
11	1026970.XP_008820309.1	0.885	HBS1 like translational GTPase
12	1026970.XP_008831459.1	0.885	60S ribosomal protein L9
13	1026970.XP_008838743.1	0.885	Ribosomal protein L13
14	1026970.XP_008849626.1	0.882	Eukaryotic translation initiation factor 3 subunit B
15	1026970.XP_008837159.1	0.880	tRNA methyltransferase 112 homolog
16	1026970.XP_008850369.1	0.878	Eukaryotic translation initiation factor 2 subunit 1
17	1026970.XP_008851659.1	0.876	Ribosomal protein L27a
18	1026970.XP_008825020.1	0.872	glutamyl-prolyl-tRNA synthetase
19	1026970.XP_008831372.1	0.870	Ribosomal protein L15
20	1026970.XP_008846216.1	0.864	Eukaryotic translation initiation factor 3 subunit I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003747	1.000	translation release factor activity
GO:0003729	0.998	mRNA binding
GO:0043022	0.995	ribosome binding
GO:1990825	0.987	sequence-specific mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0008152	0.978	metabolic process
GO:0071704	0.958	organic substance metabolic process
GO:0044237	0.950	cellular metabolic process
GO:0044238	0.931	primary metabolic process
GO:0043170	0.929	macromolecule metabolic process
GO:0006807	0.917	nitrogen compound metabolic process
GO:0034641	0.817	cellular nitrogen compound metabolic process
GO:0006412	0.795	translation
GO:0032501	0.789	multicellular organismal process
GO:0071840	0.789	cellular component organization or biogenesis
GO:0032502	0.769	developmental process
GO:0048856	0.759	anatomical structure development
GO:0065007	0.697	biological regulation
GO:0050789	0.676	regulation of biological process
GO:0007275	0.617	multicellular organism development
GO:0050794	0.498	regulation of cellular process
GO:0048731	0.492	system development
GO:0048513	0.487	animal organ development
GO:0007420	0.475	brain development
GO:0016043	0.466	cellular component organization
GO:0019222	0.436	regulation of metabolic process
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0022411	0.329	cellular component disassembly
GO:0043933	0.310	protein-containing complex organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0043226	0.899	organelle
GO:0043229	0.871	intracellular organelle
GO:0043231	0.792	intracellular membrane-bounded organelle
GO:0043232	0.642	intracellular non-membrane-bounded organelle
GO:0018444	0.486	translation release factor complex
GO:0031981	0.427	nuclear lumen
GO:0005654	0.317	nucleoplasm
GO:0016020	0.300	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]