StarFunc result for job id P62633

User Input

>input (177 residues)
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGES
GHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCY
SCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53996	0.565	0.562	3.463E-34	178	1.000	0.994	P53996.pdb.gz	CNBP_MOUSE CCHC-type zinc finger nucleic acid binding protein OS=Mus musculus OX=10090 GN=Cnbp PE=1 SV=2
2	AFDB:E7FCQ0	0.583	0.633	6.198E-26	161	0.706	0.776	E7FCQ0.pdb.gz	E7FCQ0_DANRE CCHC-type zinc finger, nucleic acid-binding protein b OS=Danio rerio OX=7955 GN=cnbp PE=1 SV=2
3	AFDB:F1Q6Z5	0.501	0.534	7.567E-25	163	0.684	0.742	F1Q6Z5.pdb.gz	F1Q6Z5_DANRE CCHC-type zinc finger, nucleic acid-binding protein a OS=Danio rerio OX=7955 GN=fe36b09 PE=1 SV=1
4	AFDB:Q8WW36	0.377	0.397	3.069E-18	166	0.571	0.608	Q8WW36.pdb.gz	ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZCCHC13 PE=1 SV=1
5	AFDB:Q8T8R1	0.236	0.249	2.637E-13	165	0.384	0.412	Q8T8R1.pdb.gz	CNBP_DROME CCHC-type zinc finger nucleic acid binding protein OS=Drosophila melanogaster OX=7227 GN=CNBP PE=1 SV=1
6	AFDB:Q59YJ9	0.286	0.282	3.219E-12	175	0.316	0.320	Q59YJ9.pdb.gz	Q59YJ9_CANAL mRNA-binding translational activator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIS2 PE=4 SV=1
7	AFDB:Q94C69	0.138	0.087	4.799E-10	301	0.429	0.252	Q94C69.pdb.gz	CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=CSP3 PE=1 SV=1
8	AFDB:Q966L9	0.218	0.050	1.621E-9	974	0.350	0.064	Q966L9.pdb.gz	GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans OX=6239 GN=glh-2 PE=1 SV=1
9	AFDB:O76743	0.273	0.066	3.905E-9	1156	0.299	0.046	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
10	AFDB:P34689	0.234	0.066	2.258E-7	763	0.328	0.076	P34689.pdb.gz	GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans OX=6239 GN=glh-1 PE=1 SV=3
11	PDB:7c4cA	0.132	0.098	2.797E-4	332	0.147	0.078	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
12	PDB:5gm6a	0.069	0.093	1.226	123	0.113	0.163	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:4kfzB	0.123	0.139	1.312	148	0.130	0.155	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
14	PDB:7uhyA	0.086	0.035	2.106	771	0.096	0.022	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7zs96	0.092	0.058	2.106	383	0.068	0.031	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:6exnc	0.118	0.102	2.253	204	0.090	0.078	6exnc.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
17	PDB:6hlqI	0.084	0.115	3.617	111	0.062	0.099	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
18	PDB:7uhyD	0.089	0.065	3.617	288	0.102	0.062	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:6t9lN	0.105	0.165	3.870	82	0.096	0.207	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
20	PDB:8a3tU	0.073	0.115	3.870	114	0.102	0.158	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62633	1.77e-127	357	177	1.000	1.000	CNBP_HUMAN CCHC-type zinc finger nucleic acid binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1
2	P62634	1.77e-127	357	177	1.000	1.000	CNBP_RAT CCHC-type zinc finger nucleic acid binding protein OS=Rattus norvegicus OX=10116 GN=Cnbp PE=2 SV=1
3	P53996	1.52e-125	352	178	1.000	0.994	CNBP_MOUSE CCHC-type zinc finger nucleic acid binding protein OS=Mus musculus OX=10090 GN=Cnbp PE=1 SV=2
4	E7FCQ0	2.67e-77	229	161	0.678	0.745	E7FCQ0_DANRE CCHC-type zinc finger, nucleic acid-binding protein b OS=Danio rerio OX=7955 GN=cnbp PE=1 SV=2
5	F1Q6Z5	3.34e-75	224	163	0.650	0.706	F1Q6Z5_DANRE CCHC-type zinc finger, nucleic acid-binding protein a OS=Danio rerio OX=7955 GN=fe36b09 PE=1 SV=1
6	Q8WW36	5.25e-51	163	166	0.537	0.572	ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZCCHC13 PE=1 SV=1
7	Q59YJ9	1.27e-29	108	175	0.350	0.354	Q59YJ9_CANAL mRNA-binding translational activator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIS2 PE=4 SV=1
8	P36627	7.42e-29	107	179	0.395	0.391	BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr3 PE=4 SV=1
9	P53849	4.18e-27	101	153	0.311	0.359	GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIS2 PE=1 SV=1
10	Q8T8R1	5.22e-23	91.7	165	0.328	0.352	CNBP_DROME CCHC-type zinc finger nucleic acid binding protein OS=Drosophila melanogaster OX=7227 GN=CNBP PE=1 SV=1
11	Q38B00	7.55e-22	89.7	213	0.356	0.296	Q38B00_TRYB2 Universal minicircle sequence binding protein (UMSBP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0820 PE=4 SV=1
12	O65639	6.66e-21	89.0	299	0.373	0.221	CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
13	Q38AZ9	8.26e-18	77.4	140	0.243	0.307	Q38AZ9_TRYB2 Universal minicircle sequence binding protein (UMSBP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0800 PE=4 SV=1
14	Q94C69	1.52e-17	80.1	301	0.412	0.243	CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=CSP3 PE=1 SV=1
15	Q9GRG8	1.69e-17	76.6	140	0.243	0.307	Q9GRG8_9TRYP CCHC zinc finger protein OS=Trypanosoma brucei OX=5691 GN=ZFP PE=2 SV=1
16	Q8GXC5	5.20e-17	77.8	257	0.333	0.230	Q8GXC5_ARATH DNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At1g75560 PE=1 SV=1
17	Q383X8	1.22e-15	75.9	516	0.288	0.099	Q383X8_TRYB2 Nucleic acid binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1270 PE=4 SV=1
18	O76743	6.69e-14	70.9	1156	0.254	0.039	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
19	Q65XV7	1.08e-12	67.4	951	0.203	0.038	RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica OX=39947 GN=RPA1C PE=1 SV=1
20	P35963	1.06e-10	61.6	1435	0.164	0.020	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	4.8e-49	173.5	Zinc knuckle
2	PF13696 zf-CCHC_2	0.18	23.0	Zinc knuckle
3	PF13917 zf-CCHC_3	0.00057	31.1	Zinc knuckle
4	PF14392 zf-CCHC_4	8.9e-08	43.0	Zinc knuckle
5	PF14787 zf-CCHC_5	1.7e-12	58.1	GAG-polyprotein viral zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9767.XP_007179233.1

Rank	PPI partner	STRING score	Description
1	9767.XP_007172291.1	0.867	Heat shock protein family A (Hsp70) member 9
2	9767.XP_007179473.1	0.847	Eukaryotic translation initiation factor 4B isoform X1
3	9767.XP_007169063.1	0.790	Eukaryotic translation initiation factor 3 subunit G
4	9767.XP_007195656.1	0.777	Ski2 like RNA helicase 2
5	9767.XP_007179511.1	0.774	poly(rC) binding protein 2
6	9767.XP_007172617.1	0.763	Adenine phosphoribosyltransferase isoform X1
7	9767.XP_007167531.1	0.751	Involved in the biogenesis of the 60S ribosomal subunit.
8	9767.XP_007176995.1	0.701	Heterogeneous nuclear ribonucleoprotein K isoform X1
9	9767.XP_007167678.1	0.678	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
10	9767.XP_007191703.1	0.678	poly(A) RNA polymerase D7, non-canonical
11	9767.XP_007196894.1	0.672	Muscleblind like splicing regulator 2
12	9767.XP_007168224.1	0.671	Myotonin-protein kinase isoform X1
13	9767.XP_007172705.1	0.665	poly(rC)-binding protein 3 isoform X1
14	9767.XP_007174590.1	0.662	Muscleblind-like protein 3 isoform X1
15	9767.XP_007188202.1	0.661	Muscleblind-like protein 1-like isoform X1
16	9767.XP_007187305.1	0.654	SUFU negative regulator of hedgehog signaling
17	9767.XP_007175616.1	0.636	poly(rC) binding protein 1
18	9767.XP_007167701.1	0.627	DnaJ heat shock protein family (Hsp40) member A2
19	9767.XP_007182883.1	0.620	ZW10 interacting kinetochore protein
20	9767.XP_007181276.1	0.591	CUGBP, Elav-like family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0003677	1.000	DNA binding
GO:0005515	0.981	protein binding
GO:0003697	0.968	single-stranded DNA binding
GO:0003729	0.951	mRNA binding
GO:0003682	0.877	chromatin binding
GO:0043565	0.633	sequence-specific DNA binding
GO:0003730	0.606	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0009889	0.972	regulation of biosynthetic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0010468	0.965	regulation of gene expression
GO:0031326	0.961	regulation of cellular biosynthetic process
GO:0010556	0.958	regulation of macromolecule biosynthetic process
GO:0051252	0.946	regulation of RNA metabolic process
GO:0048518	0.927	positive regulation of biological process
GO:0006355	0.925	regulation of DNA-templated transcription
GO:0048519	0.922	negative regulation of biological process
GO:0048522	0.917	positive regulation of cellular process
GO:0009893	0.913	positive regulation of metabolic process
GO:0010604	0.888	positive regulation of macromolecule metabolic process
GO:0048523	0.876	negative regulation of cellular process
GO:0051173	0.874	positive regulation of nitrogen compound metabolic process
GO:0044237	0.815	cellular metabolic process
GO:0006357	0.802	regulation of transcription by RNA polymerase II
GO:0045935	0.780	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.739	positive regulation of cellular biosynthetic process
GO:0010557	0.735	positive regulation of macromolecule biosynthetic process
GO:0009892	0.726	negative regulation of metabolic process
GO:0051254	0.675	positive regulation of RNA metabolic process
GO:0048878	0.671	chemical homeostasis
GO:0055088	0.656	lipid homeostasis
GO:0006807	0.619	nitrogen compound metabolic process
GO:0031324	0.594	negative regulation of cellular metabolic process
GO:0071704	0.569	organic substance metabolic process
GO:0044238	0.553	primary metabolic process
GO:0045893	0.455	positive regulation of DNA-templated transcription
GO:0034641	0.453	cellular nitrogen compound metabolic process
GO:0009890	0.426	negative regulation of biosynthetic process
GO:0050896	0.343	response to stimulus
GO:0010605	0.342	negative regulation of macromolecule metabolic process
GO:0043170	0.325	macromolecule metabolic process
GO:0032502	0.302	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.990	nucleus
GO:0012505	0.725	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]