StarFunc result for job id P62714

User Input

>input (309 residues)
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3KUN1	0.960	0.960	5.070E-66	309	0.974	0.974	B3KUN1.pdb.gz	B3KUN1_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1
2	AFDB:G5EGK8	0.953	0.926	1.163E-64	318	0.890	0.865	G5EGK8.pdb.gz	PP2A_CAEEL Serine/threonine-protein phosphatase 2A catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=let-92 PE=1 SV=1
3	AFDB:Q9XZE5	0.931	0.940	2.636E-62	306	0.816	0.824	Q9XZE5.pdb.gz	PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum OX=44689 GN=pho2a PE=1 SV=1
4	PDB:2nppC	0.952	0.955	1.054E-61	308	0.971	0.974	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
5	AFDB:O04951	0.941	0.947	1.812E-61	307	0.773	0.779	O04951.pdb.gz	PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A5 PE=1 SV=1
6	AFDB:P23635	0.958	0.958	4.475E-61	309	0.780	0.780	P23635.pdb.gz	PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppa1 PE=3 SV=1
7	AFDB:P48578	0.930	0.918	4.418E-60	313	0.790	0.780	P48578.pdb.gz	PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A4 PE=1 SV=1
8	AFDB:P23636	0.948	0.911	3.866E-59	322	0.780	0.748	P23636.pdb.gz	PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppa2 PE=3 SV=1
9	AFDB:A0A1D8PJ80	0.952	0.818	6.180E-58	360	0.738	0.633	A0A1D8PJ80.pdb.gz	A0A1D8PJ80_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PPH21 PE=3 SV=1
10	AFDB:P23595	0.935	0.768	1.353E-57	377	0.741	0.607	P23595.pdb.gz	PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPH22 PE=1 SV=1
11	AFDB:A8WGP3	0.945	0.939	3.719E-56	311	0.650	0.646	A8WGP3.pdb.gz	PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio OX=7955 GN=ppp4ca PE=2 SV=1
12	PDB:6zejI	0.891	0.786	2.776E-38	351	0.472	0.416	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
13	PDB:1s70A	0.894	0.894	5.721E-38	309	0.443	0.443	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
14	PDB:4or9A	0.878	0.684	2.002E-36	399	0.401	0.311	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
15	PDB:1wao1	0.874	0.581	2.873E-36	471	0.395	0.259	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
16	PDB:7obeA	0.878	0.572	2.099E-35	480	0.372	0.240	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
17	PDB:4il1A	0.869	0.514	5.182E-35	529	0.401	0.234	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
18	PDB:1g5bB	0.420	0.567	6.000E-9	221	0.146	0.204	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:5vjvA	0.383	0.395	1.425E-5	298	0.142	0.148	5vjvA.pdb.gz	Structural basis for the preference of the Arabidopsis thalianaphosphatase RLPH2 for tyrosine-phosphorylated substrates.
20	PDB:3ib7A	0.343	0.356	1.041E-4	295	0.142	0.149	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PJ80	506	360	0.738	0.633	A0A1D8PJ80_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PPH21 PE=3 SV=1
2	B3KUN1	637	309	0.974	0.974	B3KUN1_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1
3	G5EGK8	593	318	0.890	0.865	PP2A_CAEEL Serine/threonine-protein phosphatase 2A catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=let-92 PE=1 SV=1
4	O04951	527	307	0.773	0.779	PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A5 PE=1 SV=1
5	P23594	505	369	0.735	0.615	PP2A1_YEAST Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPH21 PE=1 SV=1
6	P23595	506	377	0.741	0.607	PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPH22 PE=1 SV=1
7	P23635	527	309	0.777	0.777	PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppa1 PE=3 SV=1
8	P23636	530	322	0.780	0.748	PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppa2 PE=3 SV=1
9	P23696	621	309	0.945	0.945	PP2A_DROME Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster OX=7227 GN=mts PE=1 SV=1
10	P48578	531	313	0.793	0.783	PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A4 PE=1 SV=1
11	P62714	649	309	1.000	1.000	PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2CB PE=1 SV=1
12	P62715	649	309	1.000	1.000	PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus OX=10090 GN=Ppp2cb PE=1 SV=1
13	P62716	649	309	1.000	1.000	PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2cb PE=2 SV=1
14	P63330	636	309	0.974	0.974	PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Ppp2ca PE=1 SV=1
15	P63331	636	309	0.974	0.974	PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp2ca PE=1 SV=1
16	P67775	637	309	0.974	0.974	PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1
17	Q07098	528	306	0.777	0.784	PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A2 PE=1 SV=1
18	Q07099	525	306	0.773	0.781	PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A1 PE=1 SV=1
19	Q07100	531	313	0.793	0.783	PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=PP2A3 PE=1 SV=2
20	Q0P594	647	309	0.997	0.997	PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus OX=9913 GN=PPP2CB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03636 Glyco_hydro_65N	71	14.5	Glycosyl hydrolase family 65, N-terminal domain
2	PF00149 Metallophos	6.9e-32	123.2	Calcineurin-like phosphoesterase
3	PF16891 STPPase_N	23	16.8	Serine-threonine protein phosphatase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10181.XP_004855515.1

Rank	PPI partner	STRING score	Description
1	10181.XP_004866796.1	0.993	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
2	10181.XP_004848424.1	0.990	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X1
3	10181.XP_004856602.1	0.989	Protein phosphatase 2 scaffold subunit Abeta
4	10181.XP_004853599.1	0.987	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
5	10181.XP_004838774.1	0.986	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
6	10181.XP_004852501.1	0.985	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
7	10181.XP_004837479.1	0.984	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
8	10181.XP_004836993.1	0.983	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
9	10181.XP_004847374.1	0.980	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform isoform X1
10	10181.XP_004846592.1	0.979	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform isoform X1
11	10181.XP_004854407.1	0.979	Belongs to the phosphatase 2A regulatory subunit B family.
12	10181.XP_004864330.1	0.974	Shugoshin-like 1 isoform X1
13	10181.XP_004867343.1	0.963	Immunoglobulin-binding protein 1-like
14	10181.XP_004872658.1	0.963	Immunoglobulin-binding protein 1-like
15	10181.XP_004836907.1	0.951	AKT kinase-transforming protein
16	10181.XP_004870428.1	0.944	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
17	10181.XP_004849197.1	0.942	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
18	10181.XP_004855658.1	0.942	Dual specificity mitogen-activated protein kinase kinase 1
19	10181.XP_004856039.1	0.942	Leucine carboxyl methyltransferase 1
20	10181.XP_004863305.1	0.934	Demethylates proteins that have been reversibly carboxymethylated

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.985	biological regulation
GO:0044238	0.977	primary metabolic process
GO:0050789	0.974	regulation of biological process
GO:0071704	0.972	organic substance metabolic process
GO:0044237	0.966	cellular metabolic process
GO:0043170	0.954	macromolecule metabolic process
GO:0006807	0.952	nitrogen compound metabolic process
GO:0050794	0.951	regulation of cellular process
GO:1901564	0.936	organonitrogen compound metabolic process
GO:0006796	0.902	phosphate-containing compound metabolic process
GO:0043412	0.789	macromolecule modification
GO:0016311	0.735	dephosphorylation
GO:0019538	0.664	protein metabolic process
GO:0050896	0.591	response to stimulus
GO:0036211	0.499	protein modification process
GO:0019222	0.469	regulation of metabolic process
GO:0048519	0.421	negative regulation of biological process
GO:0023051	0.396	regulation of signaling
GO:0010646	0.395	regulation of cell communication
GO:0048583	0.387	regulation of response to stimulus
GO:0048518	0.386	positive regulation of biological process
GO:0048523	0.356	negative regulation of cellular process
GO:0048522	0.354	positive regulation of cellular process
GO:0032502	0.341	developmental process
GO:0032501	0.328	multicellular organismal process
GO:0060255	0.320	regulation of macromolecule metabolic process
GO:0051716	0.319	cellular response to stimulus
GO:0048856	0.318	anatomical structure development
GO:0080090	0.309	regulation of primary metabolic process
GO:0031323	0.304	regulation of cellular metabolic process
GO:0051171	0.303	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.997	intracellular organelle
GO:0032991	0.994	protein-containing complex
GO:0005829	0.985	cytosol
GO:0043227	0.961	membrane-bounded organelle
GO:0008287	0.950	protein serine/threonine phosphatase complex
GO:0005634	0.950	nucleus
GO:0000159	0.916	protein phosphatase type 2A complex
GO:0043228	0.679	non-membrane-bounded organelle
GO:0043232	0.659	intracellular non-membrane-bounded organelle
GO:0016020	0.414	membrane
GO:0005654	0.386	nucleoplasm
GO:0005886	0.381	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]