StarFunc result for job id P62805

User Input

>input (103 residues)
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q59VN4	0.792	0.778	7.755E-14	105	0.932	0.914	Q59VN4.pdb.gz	Q59VN4_CANAL Histone H4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HHF1 PE=3 SV=1
2	PDB:1kx5B	0.771	0.778	2.968E-13	102	0.990	1.000	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
3	AFDB:Q76NW2	0.765	0.730	2.190E-12	108	0.738	0.704	Q76NW2.pdb.gz	H4_DICDI Histone H4 OS=Dictyostelium discoideum OX=44689 GN=H4a PE=1 SV=1
4	AFDB:Q99525	0.757	0.791	1.625E-11	98	0.806	0.847	Q99525.pdb.gz	H4G_HUMAN Histone H4-like protein type G OS=Homo sapiens OX=9606 GN=H4C7 PE=1 SV=1
5	AFDB:Q57Z31	0.866	0.891	8.378E-11	100	0.592	0.610	Q57Z31.pdb.gz	Q57Z31_TRYB2 Histone H4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.470 PE=1 SV=1
6	AFDB:Q587H6	0.860	0.885	1.538E-10	100	0.563	0.580	Q587H6.pdb.gz	Q587H6_TRYB2 Histone H4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.135 PE=3 SV=1
7	AFDB:P49847	0.585	0.108	7.257E-4	606	0.204	0.035	P49847.pdb.gz	TAF6_DROME Transcription initiation factor TFIID subunit 6 OS=Drosophila melanogaster OX=7227 GN=Taf6 PE=1 SV=2
8	AFDB:O74462	0.613	0.151	8.195E-4	452	0.184	0.042	O74462.pdb.gz	TAF6_SCHPO Transcription initiation factor TFIID subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf6 PE=1 SV=1
9	AFDB:P49905	0.675	0.373	1.110E-3	196	0.243	0.128	P49905.pdb.gz	TAF12_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12 PE=1 SV=1
10	AFDB:P53040	0.609	0.130	1.254E-3	516	0.165	0.033	P53040.pdb.gz	TAF6_YEAST Transcription initiation factor TFIID subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF6 PE=1 SV=1
11	AFDB:Q5ATZ8	0.626	0.153	1.504E-3	445	0.155	0.036	Q5ATZ8.pdb.gz	Q5ATZ8_EMENI Transcription initiation factor TFIID complex 60 kDa subunit (AFU_orthologue AFUA_5G03680) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08232 PE=3 SV=1
12	PDB:6t9iE	0.639	0.165	3.137E-3	433	0.175	0.042	6t9iE.pdb.gz
13	PDB:7egdF	0.591	0.159	4.516E-3	412	0.165	0.041	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:7pj1B	0.521	0.449	6.908E-3	122	0.194	0.164	7pj1B.pdb.gz
15	PDB:2rvqC	0.497	0.398	9.360E-3	133	0.252	0.195	2rvqC.pdb.gz
16	PDB:2rvqD	0.505	0.415	9.360E-3	129	0.155	0.124	2rvqD.pdb.gz
17	PDB:7edxl	0.630	0.608	2.191E-2	107	0.194	0.187	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:5z30G	0.517	0.489	2.474E-2	110	0.126	0.118	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
19	PDB:1b67A	0.540	0.791	3.154E-2	68	0.184	0.279	1b67A.pdb.gz
20	PDB:7xayD	0.555	0.587	3.351E-2	97	0.194	0.206	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62797	9.07e-68	200	103	1.000	1.000	H4_ONCMY Histone H4 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
2	P62799	9.07e-68	200	103	1.000	1.000	H4_XENLA Histone H4 OS=Xenopus laevis OX=8355 PE=1 SV=2
3	P62801	9.07e-68	200	103	1.000	1.000	H4_CHICK Histone H4 OS=Gallus gallus OX=9031 GN=H4-I PE=1 SV=2
4	P62803	9.07e-68	200	103	1.000	1.000	H4_BOVIN Histone H4 OS=Bos taurus OX=9913 PE=1 SV=2
5	P62804	9.07e-68	200	103	1.000	1.000	H4_RAT Histone H4 OS=Rattus norvegicus OX=10116 GN=H4c2 PE=1 SV=2
6	P62805	9.07e-68	200	103	1.000	1.000	H4_HUMAN Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2
7	P62806	9.07e-68	200	103	1.000	1.000	H4_MOUSE Histone H4 OS=Mus musculus OX=10090 GN=H4c1 PE=1 SV=2
8	A0A0B4KFZ9	3.10e-67	199	103	0.990	0.990	A0A0B4KFZ9_DROME Histone H4 OS=Drosophila melanogaster OX=7227 GN=His4r PE=3 SV=1
9	P84040	3.10e-67	199	103	0.990	0.990	H4_DROME Histone H4 OS=Drosophila melanogaster OX=7227 GN=His4 PE=1 SV=2
10	P59259	4.17e-67	198	103	0.981	0.981	H4_ARATH Histone H4 OS=Arabidopsis thaliana OX=3702 GN=At1g07660 PE=1 SV=2
11	P83865	1.65e-64	192	103	0.961	0.961	H4_PENVA Histone H4 OS=Penaeus vannamei OX=6689 PE=1 SV=2
12	P09322	3.95e-52	160	103	0.913	0.913	H4_SCHPO Histone H4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hhf1 PE=1 SV=2
13	Q6CMU6	9.60e-52	159	103	0.932	0.932	Q6CMU6_KLULA Histone H4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0_E08647g PE=1 SV=1
14	Q8NIG3	1.32e-51	159	103	0.932	0.932	H4_CANGA Histone H4 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HHF1 PE=3 SV=3
15	P02309	2.91e-51	158	103	0.922	0.922	H4_YEAST Histone H4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HHF1 PE=1 SV=2
16	Q59VN4	5.84e-51	157	105	0.835	0.819	Q59VN4_CANAL Histone H4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HHF1 PE=3 SV=1
17	Q76NW2	1.48e-44	141	108	0.670	0.639	H4_DICDI Histone H4 OS=Dictyostelium discoideum OX=44689 GN=H4a PE=1 SV=1
18	Q99525	8.65e-40	129	98	0.806	0.847	H4G_HUMAN Histone H4-like protein type G OS=Homo sapiens OX=9606 GN=H4C7 PE=1 SV=1
19	Q57Z31	2.02e-37	123	100	0.573	0.590	Q57Z31_TRYB2 Histone H4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.470 PE=1 SV=1
20	Q587H6	1.93e-36	120	100	0.553	0.570	Q587H6_TRYB2 Histone H4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.135 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07524 Bromo_TP	84	14.6	Bromodomain associated
2	PF00808 CBFD_NFYB_HMF	1.5	20.5	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
3	PF15630 CENP-S	0.22	23.3	CENP-S protein
4	PF15511 CENP-T_C	0.00022	32.6	Centromere kinetochore component CENP-T histone fold
5	PF00125 Histone	0.35	22.6	Core histone H2A/H2B/H3/H4
6	PF02969 TAF	0.061	24.8	TATA box binding protein associated factor (TAF)
7	PF02291 TFIID-31kDa	38	15.8	Transcription initiation factor IID, 31kD subunit
8	PF03677 UPF0137	7.1e+02	11.4	Uncharacterised protein family (UPF0137)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 29073.XP_008691182.1

Rank	PPI partner	STRING score	Description
1	29073.XP_008691176.1	0.921	Histone H3.1-like
2	29073.XP_008691196.1	0.921	Belongs to the histone H3 family.
3	29073.XP_008691998.1	0.921	Belongs to the histone H3 family.
4	29073.XP_008693968.1	0.921	Belongs to the histone H3 family.
5	29073.XP_008694001.1	0.921	Histone H3-like centromeric protein CSE4
6	29073.XP_008706493.1	0.921	Belongs to the histone H3 family.
7	29073.XP_008691306.1	0.911	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
8	29073.XP_008685339.1	0.901	Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG.
9	29073.XP_008691198.1	0.898	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
10	29073.XP_008691313.1	0.898	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
11	29073.XP_008691860.1	0.873	Bromodomain PHD finger transcription factor
12	29073.XP_008691177.1	0.800	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
13	29073.XP_008710060.1	0.800	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
14	29073.XP_008709352.1	0.756	SPT16 homolog, facilitates chromatin remodeling subunit
15	29073.XP_008692354.1	0.743	Structure specific recognition protein 1
16	29073.XP_008687781.1	0.704	AT-rich interactive domain-containing protein 4B
17	29073.XP_008700367.1	0.704	AT-rich interactive domain-containing protein 4A isoform X1
18	29073.XP_008689388.1	0.699	Anti-silencing function 1A histone chaperone
19	29073.XP_008709935.1	0.699	Histone chaperone ASF1B
20	29073.XP_008703673.1	0.688	TATA-box binding protein associated factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.972	DNA binding
GO:0003690	0.448	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0006325	0.981	chromatin organization
GO:0065004	0.419	protein-DNA complex assembly
GO:0034728	0.316	nucleosome organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.999	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0032991	0.961	protein-containing complex
GO:0000785	0.931	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]