StarFunc result for job id P62877

User Input

>input (108 residues)
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62877	1.000	1.000	4.276E-21	108	1.000	1.000	P62877.pdb.gz	RBX1_HUMAN E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1
2	AFDB:Q9W5E1	0.809	0.809	2.810E-18	108	0.852	0.852	Q9W5E1.pdb.gz	RBX1A_DROME RING-box protein 1A OS=Drosophila melanogaster OX=7227 GN=Roc1a PE=1 SV=1
3	AFDB:Q940X7	0.835	0.766	3.900E-18	118	0.833	0.763	Q940X7.pdb.gz	RBX1A_ARATH RING-box protein 1a OS=Arabidopsis thaliana OX=3702 GN=RBX1A PE=1 SV=1
4	AFDB:Q9M2B0	0.827	0.778	1.761E-17	115	0.815	0.765	Q9M2B0.pdb.gz	RBX1B_ARATH RING-box protein 1b OS=Arabidopsis thaliana OX=3702 GN=RBX1B PE=2 SV=1
5	AFDB:Q23457	0.729	0.716	1.635E-16	110	0.796	0.782	Q23457.pdb.gz	RBX1_CAEEL RING-box protein 1 OS=Caenorhabditis elegans OX=6239 GN=rbx-1 PE=1 SV=1
6	AFDB:O13959	0.792	0.800	1.421E-15	107	0.713	0.720	O13959.pdb.gz	RBX1_SCHPO RING-box protein pip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pip1 PE=1 SV=2
7	AFDB:Q9NHX0	0.687	0.614	2.088E-14	122	0.639	0.566	Q9NHX0.pdb.gz	RBX1B_DROME RING-box protein 1B OS=Drosophila melanogaster OX=7227 GN=Roc1b PE=2 SV=2
8	PDB:2lgvA	0.576	0.617	2.224E-14	100	0.861	0.930	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
9	AFDB:Q08273	0.677	0.610	1.592E-13	121	0.593	0.529	Q08273.pdb.gz	RBX1_YEAST RING-box protein HRT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HRT1 PE=1 SV=1
10	AFDB:Q38C61	0.679	0.691	2.069E-13	106	0.630	0.642	Q38C61.pdb.gz	Q38C61_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6035 PE=4 SV=1
11	AFDB:F4K5K0	0.597	0.466	3.496E-13	142	0.815	0.620	F4K5K0.pdb.gz	F4K5K0_ARATH RING-box 1 OS=Arabidopsis thaliana OX=3702 GN=RBX1 PE=1 SV=1
12	PDB:4a0cF	0.560	0.737	3.239E-12	80	0.741	1.000	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	PDB:7oniR	0.607	0.754	4.416E-10	86	0.407	0.512	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:5a31B	0.530	0.667	1.017E-7	84	0.306	0.393	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
15	PDB:5l9uB	0.456	0.682	5.541E-6	71	0.296	0.451	5l9uB.pdb.gz
16	PDB:8a3tU	0.512	0.486	5.541E-6	114	0.250	0.237	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
17	PDB:5gm6a	0.367	0.324	1.858E-1	123	0.111	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:5dkaA	0.369	0.412	2.262E-1	96	0.111	0.125	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
19	PDB:7egb0	0.264	0.133	3.579E-1	234	0.056	0.026	7egb0.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:4r8pL	0.391	0.180	4.080E-1	254	0.130	0.055	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62877	2.82e-78	227	108	1.000	1.000	RBX1_HUMAN E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1
2	P62878	2.82e-78	227	108	1.000	1.000	RBX1_MOUSE E3 ubiquitin-protein ligase RBX1 OS=Mus musculus OX=10090 GN=Rbx1 PE=1 SV=1
3	Q498D8	2.82e-78	227	108	1.000	1.000	Q498D8_RAT Ring-box 1 OS=Rattus norvegicus OX=10116 GN=Rbx1 PE=2 SV=1
4	A0A0G2JUC8	3.20e-71	209	115	0.944	0.887	A0A0G2JUC8_RAT Ring-box 1 OS=Rattus norvegicus OX=10116 GN=Rbx1 PE=1 SV=1
5	Q9W5E1	2.48e-65	194	108	0.852	0.852	RBX1A_DROME RING-box protein 1A OS=Drosophila melanogaster OX=7227 GN=Roc1a PE=1 SV=1
6	Q940X7	6.28e-62	186	118	0.796	0.729	RBX1A_ARATH RING-box protein 1a OS=Arabidopsis thaliana OX=3702 GN=RBX1A PE=1 SV=1
7	Q23457	1.74e-59	179	110	0.815	0.800	RBX1_CAEEL RING-box protein 1 OS=Caenorhabditis elegans OX=6239 GN=rbx-1 PE=1 SV=1
8	Q9M2B0	1.00e-58	177	115	0.778	0.730	RBX1B_ARATH RING-box protein 1b OS=Arabidopsis thaliana OX=3702 GN=RBX1B PE=2 SV=1
9	F4K5K0	3.67e-56	172	142	0.796	0.606	F4K5K0_ARATH RING-box 1 OS=Arabidopsis thaliana OX=3702 GN=RBX1 PE=1 SV=1
10	O13959	5.51e-56	171	107	0.741	0.748	RBX1_SCHPO RING-box protein pip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pip1 PE=1 SV=2
11	Q9NHX0	1.22e-45	145	122	0.630	0.557	RBX1B_DROME RING-box protein 1B OS=Drosophila melanogaster OX=7227 GN=Roc1b PE=2 SV=2
12	Q38C61	2.28e-45	144	106	0.630	0.642	Q38C61_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6035 PE=4 SV=1
13	Q08273	2.15e-43	139	121	0.593	0.529	RBX1_YEAST RING-box protein HRT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HRT1 PE=1 SV=1
14	Q7JWH5	4.67e-29	102	113	0.444	0.425	Q7JWH5_DROME MIP07211p OS=Drosophila melanogaster OX=7227 GN=Roc2 PE=2 SV=1
15	Q9UBF6	1.17e-26	97.1	113	0.407	0.389	RBX2_HUMAN RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7 PE=1 SV=1
16	Q9WTZ1	1.58e-26	96.7	113	0.407	0.389	RBX2_MOUSE RING-box protein 2 OS=Mus musculus OX=10090 GN=Rnf7 PE=1 SV=1
17	Q9M9L0	1.11e-16	70.5	84	0.296	0.381	APC11_ARATH Anaphase-promoting complex subunit 11 OS=Arabidopsis thaliana OX=3702 GN=APC11 PE=1 SV=3
18	Q9NYG5	3.71e-16	69.3	84	0.306	0.393	APC11_HUMAN Anaphase-promoting complex subunit 11 OS=Homo sapiens OX=9606 GN=ANAPC11 PE=1 SV=1
19	Q7KA43	4.16e-15	66.6	85	0.287	0.365	Q7KA43_DROME Anaphase-promoting complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=lmgA PE=2 SV=1
20	Q38DY9	7.66e-13	60.8	82	0.296	0.390	Q38DY9_TRYB2 Anaphase-promoting complex subunit 11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1655 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12861 zf-ANAPC11	4.6e-14	63.6	Anaphase-promoting complex subunit 11 RING-H2 finger
2	PF00097 zf-C3HC4	2.7	19.2	Zinc finger, C3HC4 type (RING finger)
3	PF13923 zf-C3HC4_2	1.3	20.2	Zinc finger, C3HC4 type (RING finger)
4	PF13920 zf-C3HC4_3	2.6e+02	12.9	Zinc finger, C3HC4 type (RING finger)
5	PF12678 zf-rbx1	3.6e-22	89.7	RING-H2 zinc finger domain
6	PF17120 zf-RING_16	9.1e+02	10.9	RING/Ubox like zinc-binding domain
7	PF13639 zf-RING_2	0.0066	28.1	Ring finger domain
8	PF13445 zf-RING_UBOX	9.5e+02	11.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008843039.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008820494.1	0.999	DNA damage-binding protein 1 isoform X1
2	1026970.XP_008826075.1	0.999	S-phase kinase-associated protein 1
3	1026970.XP_008827970.1	0.999	Cullin-1
4	1026970.XP_008832077.1	0.999	Cullin-2
5	1026970.XP_008840291.1	0.999	S-phase kinase-associated protein 2 isoform X1
6	1026970.XP_008843842.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
7	1026970.XP_008846647.1	0.999	cullin-4A
8	1026970.XP_008821014.1	0.998	Ubiquitin conjugating enzyme E2 M
9	1026970.XP_008824048.1	0.998	Cullin-3
10	1026970.XP_008827933.1	0.998	Cullin 5
11	1026970.XP_008832150.1	0.998	Cullin 4B
12	1026970.XP_008847118.1	0.998	Transcription elongation factor B polypeptide 1
13	1026970.XP_008853092.1	0.998	Von Hippel-Lindau disease tumor suppressor isoform X1
14	1026970.XP_008843812.1	0.997	Beta-transducin repeat containing E3 ubiquitin protein ligase
15	1026970.XP_008827231.1	0.993	Ubiquitin conjugating enzyme E2 D1
16	1026970.XP_008835438.1	0.993	Cell division cycle 34
17	1026970.XP_008827322.1	0.992	Cullin 7
18	1026970.XP_008852778.1	0.992	Cereblon
19	1026970.XP_008845182.1	0.991	Cullin-associated NEDD8-dissociated protein 1
20	1026970.XP_008825069.1	0.989	Glomulin, FKBP associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061659	0.968	ubiquitin-like protein ligase activity
GO:0061630	0.914	ubiquitin protein ligase activity
GO:0097602	0.820	cullin family protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0009987	0.984	cellular process
GO:0050789	0.983	regulation of biological process
GO:0050896	0.972	response to stimulus
GO:0006508	0.970	proteolysis
GO:0050794	0.966	regulation of cellular process
GO:0070647	0.900	protein modification by small protein conjugation or removal
GO:0044237	0.898	cellular metabolic process
GO:0016567	0.882	protein ubiquitination
GO:0006511	0.866	ubiquitin-dependent protein catabolic process
GO:0051716	0.858	cellular response to stimulus
GO:0043161	0.830	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0000209	0.811	protein polyubiquitination
GO:0031146	0.657	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0009628	0.595	response to abiotic stimulus
GO:0019222	0.581	regulation of metabolic process
GO:0009411	0.529	response to UV
GO:0104004	0.525	cellular response to environmental stimulus
GO:0006950	0.513	response to stress
GO:0070936	0.512	protein K48-linked ubiquitination
GO:0034644	0.502	cellular response to UV
GO:0048518	0.491	positive regulation of biological process
GO:0060255	0.489	regulation of macromolecule metabolic process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0006513	0.479	protein monoubiquitination
GO:0080090	0.475	regulation of primary metabolic process
GO:0031323	0.456	regulation of cellular metabolic process
GO:0048522	0.455	positive regulation of cellular process
GO:0048519	0.441	negative regulation of biological process
GO:0048523	0.426	negative regulation of cellular process
GO:0033554	0.413	cellular response to stress
GO:0009893	0.380	positive regulation of metabolic process
GO:0010604	0.315	positive regulation of macromolecule metabolic process
GO:0051173	0.310	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0000151	1.000	ubiquitin ligase complex
GO:0005634	1.000	nucleus
GO:0005829	0.989	cytosol
GO:0031461	0.989	cullin-RING ubiquitin ligase complex
GO:0005654	0.989	nucleoplasm
GO:0019005	0.937	SCF ubiquitin ligase complex
GO:0080008	0.886	Cul4-RING E3 ubiquitin ligase complex
GO:0140513	0.722	nuclear protein-containing complex
GO:0005680	0.490	anaphase-promoting complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]