StarFunc result for job id P62879

User Input

>input (340 residues)
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11017	1.000	1.000	2.499E-70	340	1.000	1.000	P11017.pdb.gz	GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus OX=9913 GN=GNB2 PE=2 SV=3
2	AFDB:A8K3F6	0.999	0.999	2.297E-66	340	0.894	0.894	A8K3F6.pdb.gz	A8K3F6_HUMAN cDNA FLJ77654, highly similar to Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 4 (GNB4), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:B2R6K4	0.999	0.999	6.637E-66	340	0.894	0.894	B2R6K4.pdb.gz	B2R6K4_HUMAN cDNA, FLJ92996, highly similar to Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:P17343	0.999	0.999	1.918E-65	340	0.853	0.853	P17343.pdb.gz	GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=gpb-1 PE=1 SV=2
5	AFDB:P26308	0.999	0.999	8.472E-65	340	0.815	0.815	P26308.pdb.gz	GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=Gbeta13F PE=1 SV=1
6	AFDB:P16520	0.999	0.999	2.528E-63	340	0.809	0.809	P16520.pdb.gz	GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens OX=9606 GN=GNB3 PE=1 SV=1
7	AFDB:P36408	0.986	0.966	1.037E-56	347	0.647	0.634	P36408.pdb.gz	GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum OX=44689 GN=gpbA PE=1 SV=1
8	AFDB:Q4WVI4	0.981	0.863	4.831E-56	387	0.656	0.576	Q4WVI4.pdb.gz	Q4WVI4_ASPFU G protein complex beta subunit SfaD OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G12210 PE=3 SV=1
9	PDB:7jvrB	0.991	0.986	1.761E-55	342	0.900	0.895	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
10	AFDB:A0A3S5ZPL0	0.969	0.731	4.490E-45	452	0.518	0.389	A0A3S5ZPL0.pdb.gz	A0A3S5ZPL0_BOVIN G protein subunit beta 5 OS=Bos taurus OX=9913 GN=GNB5 PE=3 SV=1
11	AFDB:Q20636	0.958	0.884	3.555E-44	369	0.479	0.442	Q20636.pdb.gz	GBB2_CAEEL Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans OX=6239 GN=gpb-2 PE=1 SV=3
12	PDB:7ewpD	0.921	0.923	5.206E-36	339	0.509	0.510	7ewpD.pdb.gz
13	PDB:7ad3F	0.864	0.922	3.592E-31	318	0.374	0.399	7ad3F.pdb.gz	Structure of the class D GPCR Ste2 dimer coupled to two G proteins.
14	PDB:5mzhB	0.731	0.611	9.539E-27	415	0.250	0.205	5mzhB.pdb.gz
15	PDB:3jcmB	0.807	0.647	4.214E-26	429	0.265	0.210	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
16	PDB:2h9lA	0.808	0.854	1.192E-24	321	0.215	0.227	2h9lA.pdb.gz
17	PDB:3dm0A	0.796	0.410	3.199E-23	675	0.221	0.111	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
18	PDB:1vyhC	0.808	0.883	3.557E-23	310	0.200	0.219	1vyhC.pdb.gz
19	PDB:5nnzA	0.722	0.731	4.171E-23	335	0.224	0.227	5nnzA.pdb.gz
20	PDB:5jcsq	0.685	0.496	6.723E-23	488	0.224	0.156	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A8K3F6	645	340	0.894	0.894	A8K3F6_HUMAN cDNA FLJ77654, highly similar to Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 4 (GNB4), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	B2R6K4	624	340	0.894	0.894	B2R6K4_HUMAN cDNA, FLJ92996, highly similar to Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	O35353	623	340	0.897	0.897	GBB4_RAT Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Gnb4 PE=2 SV=4
4	P11017	702	340	1.000	1.000	GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus OX=9913 GN=GNB2 PE=2 SV=3
5	P16520	595	340	0.809	0.809	GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens OX=9606 GN=GNB3 PE=1 SV=1
6	P17343	622	340	0.853	0.853	GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=gpb-1 PE=1 SV=2
7	P26308	598	340	0.815	0.815	GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=Gbeta13F PE=1 SV=1
8	P29387	622	340	0.894	0.894	GBB4_MOUSE Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus OX=10090 GN=Gnb4 PE=1 SV=4
9	P52287	594	340	0.809	0.809	GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Gnb3 PE=1 SV=1
10	P54311	630	340	0.903	0.903	GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Gnb1 PE=1 SV=4
11	P54313	702	340	1.000	1.000	GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gnb2 PE=1 SV=4
12	P62871	630	340	0.903	0.903	GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus OX=9913 GN=GNB1 PE=1 SV=3
13	P62873	630	340	0.903	0.903	GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1 PE=1 SV=3
14	P62874	630	340	0.903	0.903	GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3
15	P62879	702	340	1.000	1.000	GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens OX=9606 GN=GNB2 PE=1 SV=3
16	P62880	702	340	1.000	1.000	GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus OX=10090 GN=Gnb2 PE=1 SV=3
17	Q61011	590	340	0.803	0.803	GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus OX=10090 GN=Gnb3 PE=1 SV=2
18	Q6FHM2	702	340	1.000	1.000	Q6FHM2_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=GNB2 PE=2 SV=1
19	Q6PH57	654	340	0.912	0.912	GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio OX=7955 GN=gnb1 PE=2 SV=1
20	Q803H5	652	340	0.909	0.909	Q803H5_DANRE Gnb1l protein OS=Danio rerio OX=7955 GN=gnb1l PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.8e-14	63.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16025 CaM_bind	1.6e+02	14.1	Calcium-dependent calmodulin binding
3	PF02239 Cytochrom_D1	3.7e+02	11.0	Cytochrome D1 heme domain
4	PF16529 Ge1_WD40	4.8	17.7	WD40 region of Ge1, enhancer of mRNA-decapping protein
5	PF20426 NBCH_WD40	1.9e-09	48.5	Neurobeachin beta propeller domain
6	PF00400 WD40	3.9e-39	143.1	WD domain, G-beta repeat
7	PF17005 WD40_like	0.033	25.1	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000001715

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000004472	0.995	Guanine nucleotide binding protein (G protein), gamma 13
2	9361.ENSDNOP00000016406	0.995	Guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1
3	9361.ENSDNOP00000010396	0.994	Guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1
4	9361.ENSDNOP00000011726	0.993	Rhodopsin
5	9361.ENSDNOP00000029509	0.993	Guanine nucleotide binding protein (G protein), gamma 11
6	9361.ENSDNOP00000031182	0.993	Guanine nucleotide binding protein (G protein), gamma 7
7	9361.ENSDNOP00000021564	0.991	Guanine nucleotide binding protein (G protein), gamma 5
8	9361.ENSDNOP00000005031	0.990	Guanine nucleotide binding protein (G protein), gamma 3
9	9361.ENSDNOP00000033787	0.990	Guanine nucleotide binding protein (G protein), gamma 12
10	9361.ENSDNOP00000028069	0.989	Guanine nucleotide binding protein (G protein), gamma 4
11	9361.ENSDNOP00000032760	0.989	Guanine nucleotide binding protein (G protein), gamma 10
12	9361.ENSDNOP00000019842	0.987	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
13	9361.ENSDNOP00000018681	0.985	annotation not available
14	9361.ENSDNOP00000014257	0.982	annotation not available
15	9361.ENSDNOP00000007145	0.978	5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled
16	9361.ENSDNOP00000010586	0.978	annotation not available
17	9361.ENSDNOP00000034109	0.978	annotation not available
18	9361.ENSDNOP00000014253	0.977	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3
19	9361.ENSDNOP00000026431	0.977	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1
20	9361.ENSDNOP00000004921	0.976	Guanine nucleotide binding protein (G protein), q polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.995	hydrolase activity
GO:0016817	0.953	hydrolase activity, acting on acid anhydrides
GO:0017111	0.900	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.753	GTPase activity
GO:0019899	0.595	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0007154	0.988	cell communication
GO:0051716	0.985	cellular response to stimulus
GO:0007165	0.979	signal transduction
GO:0007186	0.949	G protein-coupled receptor signaling pathway
GO:0032501	0.393	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005886	0.998	plasma membrane
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.994	intracellular organelle
GO:0005737	0.993	cytoplasm
GO:0005829	0.978	cytosol
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0032991	0.965	protein-containing complex
GO:0098796	0.871	membrane protein complex
GO:0120025	0.843	plasma membrane bounded cell projection
GO:1905360	0.832	GTPase complex
GO:0019897	0.830	extrinsic component of plasma membrane
GO:0031090	0.828	organelle membrane
GO:0031234	0.821	extrinsic component of cytoplasmic side of plasma membrane
GO:0098797	0.795	plasma membrane protein complex
GO:0005834	0.788	heterotrimeric G-protein complex
GO:0044297	0.718	cell body
GO:0043005	0.711	neuron projection
GO:0005773	0.704	vacuole
GO:0098588	0.686	bounding membrane of organelle
GO:0005764	0.668	lysosome
GO:0005774	0.645	vacuolar membrane
GO:0005576	0.500	extracellular region
GO:0031982	0.456	vesicle
GO:0098852	0.445	lytic vacuole membrane
GO:1903561	0.367	extracellular vesicle
GO:0070062	0.363	extracellular exosome
GO:0005929	0.338	cilium
GO:0005765	0.319	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.995	Hydrolases.
EC:3.6.-.-	0.953	Acting on acid anhydrides.
RHEA:23680	0.900	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.900	nucleoside-triphosphate phosphatase.
RHEA:19669	0.753	GTP + H2O = GDP + H(+) + phosphate

[back to server]