StarFunc result for job id P62937

User Input

>input (165 residues)
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62937	1.000	1.000	1.198E-39	165	1.000	1.000	P62937.pdb.gz	PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2
2	PDB:4n1mA	0.996	0.978	3.983E-37	168	1.000	0.982	4n1mA.pdb.gz	Mapping the binding surface of Cyclophilin A.
3	AFDB:Q9Y536	0.989	0.995	4.673E-35	164	0.855	0.860	Q9Y536.pdb.gz	PAL4A_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1
4	AFDB:A3RL80	0.992	0.998	5.283E-34	164	0.752	0.756	A3RL80.pdb.gz	A3RL80_ICTPU Peptidyl-prolyl cis-trans isomerase OS=Ictalurus punctatus OX=7998 PE=2 SV=1
5	AFDB:Q6PC53	0.991	0.997	6.366E-34	164	0.752	0.756	Q6PC53.pdb.gz	Q6PC53_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=ppial PE=1 SV=1
6	AFDB:P30404	0.995	0.789	1.520E-33	208	0.764	0.606	P30404.pdb.gz	PPIF_BOVIN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Bos taurus OX=9913 GN=PPIF PE=1 SV=3
7	AFDB:P25007	0.984	0.716	6.763E-33	227	0.727	0.529	P25007.pdb.gz	PPIA_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=Cyp1 PE=1 SV=2
8	AFDB:P21568	0.988	0.953	1.340E-32	171	0.733	0.708	P21568.pdb.gz	CYPH_SOLLC Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum OX=4081 GN=CYP PE=1 SV=1
9	AFDB:G8XQW2	0.993	0.948	1.829E-32	173	0.733	0.699	G8XQW2.pdb.gz	G8XQW2_GOSHI Peptidyl-prolyl cis-trans isomerase OS=Gossypium hirsutum OX=3635 GN=LOC107916701 PE=2 SV=1
10	AFDB:Q42406	0.993	0.953	2.071E-32	172	0.721	0.692	Q42406.pdb.gz	CP18D_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana OX=3702 GN=CYP18-4 PE=1 SV=1
11	AFDB:Q387G2	0.975	0.909	2.346E-32	177	0.739	0.689	Q387G2.pdb.gz	Q387G2_TRYB2 Peptidyl-prolyl cis-trans isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0250 PE=3 SV=1
12	PDB:5yzg1	0.980	0.667	5.055E-31	243	0.661	0.449	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:1e3bA	0.980	0.940	4.188E-30	172	0.697	0.669	1e3bA.pdb.gz	First Crystal Structure of a Medicinally Relevant Gold Protein Complex:Unexpected Binding of [Au(Pet (3))](+) to Histidine
14	PDB:1vdnA	0.964	0.988	4.456E-30	161	0.642	0.658	1vdnA.pdb.gz	Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
15	PDB:3iciA	0.961	0.850	3.685E-28	187	0.648	0.572	3iciA.pdb.gz	Structural Basis of Cyclophilin B Binding by the Calnexin/Calreticulin P-domain.
16	PDB:1mzwA	0.964	0.920	1.639E-27	173	0.558	0.532	1mzwA.pdb.gz
17	PDB:1ihgA	0.962	0.440	2.533E-27	364	0.624	0.283	1ihgA.pdb.gz
18	PDB:1h0pA	0.951	0.864	2.233E-26	182	0.564	0.511	1h0pA.pdb.gz
19	PDB:7wffj	0.944	0.901	3.902E-25	173	0.642	0.613	7wffj.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
20	PDB:2mc9A	0.876	0.818	4.145E-24	178	0.739	0.685	2mc9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62937	6.44e-121	339	165	1.000	1.000	PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2
2	V9HWF5	6.44e-121	339	165	1.000	1.000	V9HWF5_HUMAN Peptidyl-prolyl cis-trans isomerase OS=Homo sapiens OX=9606 GN=HEL-S-69p PE=1 SV=1
3	P14851	3.14e-117	330	164	0.964	0.970	PPIA_CRIGR Peptidyl-prolyl cis-trans isomerase A OS=Cricetulus griseus OX=10029 GN=PPIA PE=2 SV=2
4	P17742	3.88e-116	327	164	0.958	0.963	PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus OX=10090 GN=Ppia PE=1 SV=2
5	P10111	1.34e-115	326	164	0.958	0.963	PPIA_RAT Peptidyl-prolyl cis-trans isomerase A OS=Rattus norvegicus OX=10116 GN=Ppia PE=1 SV=2
6	Q2Y080	9.66e-115	323	164	0.952	0.957	Q2Y080_AOTAZ Peptidyl-prolyl cis-trans isomerase (Fragment) OS=Aotus azarae OX=30591 PE=1 SV=1
7	Q9Y536	5.68e-103	294	164	0.855	0.860	PAL4A_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1
8	P29117	1.50e-94	274	206	0.764	0.612	PPIF_RAT Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ppif PE=1 SV=2
9	Q99KR7	3.63e-94	273	206	0.758	0.607	PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Mus musculus OX=10090 GN=Ppif PE=1 SV=1
10	P30404	1.97e-93	271	208	0.764	0.606	PPIF_BOVIN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Bos taurus OX=9913 GN=PPIF PE=1 SV=3
11	E3TF51	9.57e-93	268	164	0.782	0.787	E3TF51_ICTPU Peptidyl-prolyl cis-trans isomerase OS=Ictalurus punctatus OX=7998 GN=PPIA PE=2 SV=1
12	P30405	1.35e-92	269	207	0.752	0.599	PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1
13	Q6PC53	9.47e-90	260	164	0.752	0.756	Q6PC53_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=ppial PE=1 SV=1
14	Q4JI29	1.71e-89	259	164	0.758	0.762	Q4JI29_ICTPU Peptidyl-prolyl cis-trans isomerase OS=Ictalurus punctatus OX=7998 PE=2 SV=1
15	Q39613	3.22e-89	259	172	0.752	0.721	CYPH_CATRO Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus OX=4058 GN=PCKR1 PE=1 SV=1
16	A3RL80	2.99e-88	256	164	0.752	0.756	A3RL80_ICTPU Peptidyl-prolyl cis-trans isomerase OS=Ictalurus punctatus OX=7998 PE=2 SV=1
17	G8XQW2	7.02e-88	256	173	0.739	0.705	G8XQW2_GOSHI Peptidyl-prolyl cis-trans isomerase OS=Gossypium hirsutum OX=3635 GN=LOC107916701 PE=2 SV=1
18	P25007	1.28e-87	257	227	0.727	0.529	PPIA_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=Cyp1 PE=1 SV=2
19	Q387G2	1.14e-86	253	177	0.739	0.689	Q387G2_TRYB2 Peptidyl-prolyl cis-trans isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0250 PE=3 SV=1
20	P21568	1.19e-86	253	171	0.739	0.713	CYPH_SOLLC Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum OX=4081 GN=CYP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00160 Pro_isomerase	5.8e-44	161.6	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010385213.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010373246.1	0.694	Basigin (Ok blood group)
2	61622.XP_010353289.1	0.638	RAN, member RAS oncogene family
3	61622.XP_010374892.1	0.638	Ran GTPase-activating protein 1 isoform X1
4	61622.XP_010359777.1	0.630	NACHT and WD repeat domain-containing protein 1 isoform X1
5	61622.XP_010386100.1	0.624	Belongs to the ubiquitin-conjugating enzyme family.
6	61622.XP_010381030.1	0.607	SNW domain-containing protein 1 isoform X1
7	61622.XP_010377217.1	0.596	acyl-CoA dehydrogenase family member 10 isoform X1
8	61622.XP_010351026.1	0.594	Nucleoporin 153
9	61622.XP_010366717.1	0.582	Nuclear receptor corepressor 2
10	61622.XP_010386050.1	0.582	Nuclear receptor corepressor 1
11	61622.XP_010383262.1	0.573	pre-mRNA-processing factor 19
12	61622.XP_010358875.1	0.572	CWC15 spliceosome associated protein homolog
13	61622.XP_010371814.1	0.565	pre-mRNA processing factor 8
14	61622.XP_010370819.1	0.563	May play a role during erythropoiesis through regulation of transcription factor DDIT3
15	61622.XP_010381248.1	0.563	Splicing factor 3B subunit 3
16	61622.XP_010374069.1	0.561	Protein BUD31 homolog
17	61622.XP_010377662.1	0.557	Karyopherin subunit beta 1
18	61622.XP_010360199.1	0.555	Small nuclear ribonucleoprotein G isoform X1
19	61622.XP_010364156.1	0.549	WD repeat-containing protein 38 isoform X1
20	61622.XP_010378937.1	0.546	Protein phosphatase 3 regulatory subunit B, alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003755	1.000	peptidyl-prolyl cis-trans isomerase activity
GO:0033218	0.970	amide binding
GO:0016018	0.927	cyclosporin A binding
GO:0097159	0.686	organic cyclic compound binding
GO:1901363	0.679	heterocyclic compound binding
GO:0003676	0.596	nucleic acid binding
GO:0003723	0.459	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0065007	0.979	biological regulation
GO:0050794	0.971	regulation of cellular process
GO:0008152	0.807	metabolic process
GO:0019222	0.782	regulation of metabolic process
GO:0050896	0.777	response to stimulus
GO:0060255	0.727	regulation of macromolecule metabolic process
GO:0071704	0.716	organic substance metabolic process
GO:0080090	0.711	regulation of primary metabolic process
GO:0051171	0.711	regulation of nitrogen compound metabolic process
GO:0044238	0.689	primary metabolic process
GO:0048518	0.661	positive regulation of biological process
GO:0006807	0.643	nitrogen compound metabolic process
GO:0031323	0.635	regulation of cellular metabolic process
GO:0048519	0.602	negative regulation of biological process
GO:0043170	0.595	macromolecule metabolic process
GO:0048522	0.590	positive regulation of cellular process
GO:1901564	0.556	organonitrogen compound metabolic process
GO:0019538	0.540	protein metabolic process
GO:0048523	0.480	negative regulation of cellular process
GO:0006950	0.379	response to stress
GO:0048583	0.375	regulation of response to stimulus
GO:0044237	0.369	cellular metabolic process
GO:0009893	0.354	positive regulation of metabolic process
GO:0071840	0.350	cellular component organization or biogenesis
GO:0065009	0.329	regulation of molecular function
GO:0051716	0.321	cellular response to stimulus
GO:0010604	0.320	positive regulation of macromolecule metabolic process
GO:0032501	0.318	multicellular organismal process
GO:0009892	0.317	negative regulation of metabolic process
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0051173	0.310	positive regulation of nitrogen compound metabolic process
GO:0051246	0.308	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0070013	0.997	intracellular organelle lumen
GO:0070062	0.989	extracellular exosome
GO:0012505	0.982	endomembrane system
GO:0005829	0.979	cytosol
GO:0032991	0.908	protein-containing complex
GO:0005634	0.877	nucleus
GO:0030054	0.811	cell junction
GO:0031410	0.789	cytoplasmic vesicle
GO:0016020	0.744	membrane
GO:0031981	0.456	nuclear lumen
GO:0005654	0.402	nucleoplasm
GO:0030055	0.336	cell-substrate junction
GO:0030141	0.335	secretory granule
GO:0005925	0.328	focal adhesion
GO:0034774	0.315	secretory granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16237	1.000	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	1.000	peptidylprolyl isomerase.

[back to server]