StarFunc result for job id P62942

User Input

>input (108 residues)
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1fklA	0.978	0.987	7.584E-20	107	0.963	0.972	1fklA.pdb.gz	Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
2	AFDB:Q0VDC6	0.994	0.741	1.193E-19	145	1.000	0.745	Q0VDC6.pdb.gz	Q0VDC6_HUMAN peptidylprolyl isomerase OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=1
3	AFDB:P97534	0.995	0.995	4.853E-19	108	0.824	0.824	P97534.pdb.gz	FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus OX=10116 GN=Fkbp1b PE=1 SV=3
4	AFDB:Q8AVL7	0.997	0.810	5.122E-19	133	0.833	0.677	Q8AVL7.pdb.gz	Q8AVL7_XENLA peptidylprolyl isomerase (Fragment) OS=Xenopus laevis OX=8355 GN=FKBP1B PE=2 SV=1
5	PDB:4c02B	0.987	0.987	5.895E-19	108	0.833	0.833	4c02B.pdb.gz	Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
6	AFDB:O42123	0.997	0.997	8.325E-19	108	0.843	0.843	O42123.pdb.gz	FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis OX=8355 GN=fkbp1a PE=3 SV=3
7	AFDB:A0A060WZU7	0.996	0.996	8.787E-19	108	0.787	0.787	A0A060WZU7.pdb.gz	A0A060WZU7_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006391001 PE=4 SV=1
8	AFDB:C1BFZ3	0.997	0.997	1.033E-18	108	0.778	0.778	C1BFZ3.pdb.gz	C1BFZ3_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
9	AFDB:P48375	0.994	0.994	2.321E-18	108	0.759	0.759	P48375.pdb.gz	FKB12_DROME Peptidyl-prolyl cis-trans isomerase Fkbp12 OS=Drosophila melanogaster OX=7227 GN=Fkbp12 PE=3 SV=2
10	PDB:2nd5A	0.967	0.942	2.398E-18	111	1.000	0.973	2nd5A.pdb.gz
11	AFDB:O94746	0.984	0.984	2.539E-16	108	0.611	0.611	O94746.pdb.gz	FKBP_CRYNH FK506-binding protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=FRR1 PE=1 SV=1
12	AFDB:Q4WLV6	0.984	0.950	9.273E-16	112	0.574	0.554	Q4WLV6.pdb.gz	FKB1A_ASPFU FK506-binding protein 1A OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=fpr1A PE=1 SV=1
13	AFDB:O42993	0.987	0.952	1.772E-15	112	0.574	0.554	O42993.pdb.gz	FKBP_SCHPO Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fkh1 PE=3 SV=1
14	PDB:6tz8C	0.965	0.940	4.836E-15	111	0.546	0.532	6tz8C.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
15	PDB:7u0sA	0.974	0.850	1.087E-14	124	0.574	0.500	7u0sA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
16	PDB:7zw0sk	0.948	0.899	3.968E-14	114	0.565	0.535	7zw0sk.pdb.gz	Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
17	PDB:5hw8B	0.932	0.829	7.314E-13	122	0.491	0.434	5hw8B.pdb.gz	Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
18	PDB:5njxA	0.966	0.257	2.671E-12	413	0.472	0.123	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
19	PDB:4mspA	0.905	0.531	2.576E-11	189	0.370	0.212	4mspA.pdb.gz	Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
20	PDB:2mphA	0.895	0.447	5.196E-11	224	0.426	0.205	2mphA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62942	1.09e-77	225	108	1.000	1.000	FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2
2	P62943	1.09e-77	225	108	1.000	1.000	FKB1A_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryctolagus cuniculus OX=9986 GN=FKBP1A PE=1 SV=2
3	Q0VDC6	2.30e-77	226	145	1.000	0.745	Q0VDC6_HUMAN peptidylprolyl isomerase OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=1
4	P18203	5.87e-76	221	108	0.972	0.972	FKB1A_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Bos taurus OX=9913 GN=FKBP1A PE=1 SV=2
5	P26883	5.10e-75	219	108	0.972	0.972	FKB1A_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus OX=10090 GN=Fkbp1a PE=1 SV=2
6	Q62658	5.10e-75	219	108	0.972	0.972	FKB1A_RAT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Rattus norvegicus OX=10116 GN=Fkbp1a PE=1 SV=3
7	B5G2R5	2.71e-73	214	108	0.917	0.917	B5G2R5_TAEGU peptidylprolyl isomerase OS=Taeniopygia guttata OX=59729 PE=2 SV=1
8	Q90ZG0	2.71e-73	214	108	0.917	0.917	Q90ZG0_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP12 PE=2 SV=1
9	Q8AVL7	2.71e-68	202	133	0.833	0.677	Q8AVL7_XENLA peptidylprolyl isomerase (Fragment) OS=Xenopus laevis OX=8355 GN=FKBP1B PE=2 SV=1
10	Q5XG46	1.15e-67	200	108	0.833	0.833	Q5XG46_XENLA peptidylprolyl isomerase OS=Xenopus laevis OX=8355 GN=fkbp1b.S PE=2 SV=1
11	P68106	3.88e-67	199	108	0.833	0.833	FKB1B_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens OX=9606 GN=FKBP1B PE=1 SV=2
12	P97534	2.51e-66	197	108	0.824	0.824	FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus OX=10116 GN=Fkbp1b PE=1 SV=3
13	Q9Z2I2	3.56e-66	196	108	0.824	0.824	FKB1B_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus musculus OX=10090 GN=Fkbp1b PE=1 SV=3
14	Q8HYX6	5.23e-66	196	108	0.824	0.824	FKB1B_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Oryctolagus cuniculus OX=9986 GN=FKBP1B PE=3 SV=3
15	O42123	1.11e-65	195	108	0.843	0.843	FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis OX=8355 GN=fkbp1a PE=3 SV=3
16	Q8QGU2	1.40e-65	195	108	0.806	0.806	Q8QGU2_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP12.6 PE=2 SV=1
17	A0A060WZU7	2.75e-63	189	108	0.787	0.787	A0A060WZU7_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006391001 PE=4 SV=1
18	C1BFZ3	6.21e-62	186	108	0.778	0.778	C1BFZ3_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
19	C1BH42	7.42e-61	183	108	0.769	0.769	C1BH42_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
20	G1T0U7	8.29e-59	177	96	0.741	0.833	G1T0U7_RABIT peptidylprolyl isomerase OS=Oryctolagus cuniculus OX=9986 GN=FKBP1B PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00254 FKBP_C	1.8e-30	116.4	FKBP-type peptidyl-prolyl cis-trans isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000016929

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000015778	0.994	Serine/threonine-protein kinase mTOR
2	9555.ENSPANP00000019043	0.992	Receptor protein serine/threonine kinase
3	9555.ENSPANP00000005617	0.985	Ryanodine receptor 1 (skeletal)
4	9555.ENSPANP00000011132	0.984	annotation not available
5	9555.ENSPANP00000016026	0.978	Serine/threonine-protein kinase receptor
6	9555.ENSPANP00000007752	0.953	Uncharacterized protein
7	9555.ENSPANP00000001593	0.939	Peptidylprolyl isomerase
8	9555.ENSPANP00000016248	0.935	Uncharacterized protein
9	9555.ENSPANP00000018593	0.934	Transgelin 3
10	9555.ENSPANP00000020245	0.923	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
11	9555.ENSPANP00000020307	0.922	Protein phosphatase 3, catalytic subunit, beta isozyme
12	9555.ENSPANP00000002117	0.921	Protein phosphatase 3, catalytic subunit, alpha isozyme
13	9555.ENSPANP00000015802	0.911	Receptor protein serine/threonine kinase
14	9555.ENSPANP00000006385	0.889	Protein phosphatase 3, catalytic subunit, gamma isozyme
15	9555.ENSPANP00000000206	0.867	annotation not available
16	9555.ENSPANP00000020299	0.867	annotation not available
17	9555.ENSPANP00000020300	0.867	Nucleoside diphosphate kinase
18	9555.ENSPANP00000006524	0.853	Serine/threonine-protein kinase receptor
19	9555.ENSPANP00000017839	0.852	Eukaryotic translation initiation factor 4E binding protein 1
20	9555.ENSPANP00000020400	0.846	Ribosomal protein S6 kinase, 70kDa, polypeptide 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.976	organic cyclic compound binding
GO:1901363	0.975	heterocyclic compound binding
GO:0003824	0.940	catalytic activity
GO:0005527	0.914	macrolide binding
GO:0140096	0.879	catalytic activity, acting on a protein
GO:0016853	0.817	isomerase activity
GO:0003755	0.813	peptidyl-prolyl cis-trans isomerase activity
GO:0033218	0.613	amide binding
GO:0005528	0.354	FK506 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051282	0.994	regulation of sequestering of calcium ion
GO:0034762	0.992	regulation of transmembrane transport
GO:0065009	0.958	regulation of molecular function
GO:1903169	0.898	regulation of calcium ion transmembrane transport
GO:0051279	0.894	regulation of release of sequestered calcium ion into cytosol
GO:0009987	0.697	cellular process
GO:2001257	0.688	regulation of cation channel activity
GO:1901019	0.576	regulation of calcium ion transmembrane transporter activity
GO:0008152	0.367	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0016020	0.927	membrane
GO:0012505	0.879	endomembrane system
GO:0005783	0.808	endoplasmic reticulum
GO:0005634	0.790	nucleus
GO:0016529	0.785	sarcoplasmic reticulum
GO:0031984	0.764	organelle subcompartment
GO:0098827	0.747	endoplasmic reticulum subcompartment
GO:0005829	0.548	cytosol
GO:0032991	0.409	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.-.-.-	0.817	Isomerases.
RHEA:16237	0.813	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	0.813	peptidylprolyl isomerase.

[back to server]