StarFunc result for job id P62955

User Input

>input (275 residues)
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62955	1.000	1.000	5.295E-47	275	1.000	1.000	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
2	AFDB:Q8VHW8	0.715	0.715	2.284E-34	275	0.716	0.716	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
3	PDB:7rz4A	0.638	0.183	2.256E-24	993	0.531	0.147	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
4	AFDB:O88602	0.633	0.544	4.423E-17	323	0.302	0.257	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
5	AFDB:Q6PFS3	0.651	0.558	4.680E-17	324	0.284	0.241	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
6	AFDB:O60359	0.621	0.546	1.030E-16	315	0.269	0.235	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
7	AFDB:Q8VHW9	0.620	0.527	1.164E-15	327	0.280	0.235	Q8VHW9.pdb.gz	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
8	AFDB:Q8WXS5	0.646	0.431	5.971E-15	425	0.265	0.172	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
9	PDB:7ocaI	0.557	0.808	4.901E-13	185	0.222	0.330	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
10	AFDB:B1AQL3	0.601	0.769	3.491E-12	211	0.175	0.227	B1AQL3.pdb.gz	TM235_MOUSE Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3
11	AFDB:Q9VRE6	0.601	0.383	5.481E-12	447	0.189	0.116	Q9VRE6.pdb.gz	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
12	AFDB:G5EDT2	0.605	0.464	1.693E-11	366	0.215	0.161	G5EDT2.pdb.gz	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1
13	PDB:5weoA	0.571	0.170	5.910E-11	988	0.233	0.065	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
14	PDB:5kbtA	0.517	0.167	6.310E-10	973	0.229	0.065	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
15	PDB:6jp5E	0.474	0.751	3.115E-7	169	0.142	0.231	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
16	PDB:7rzaA	0.536	0.164	3.296E-7	981	0.156	0.044	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
17	PDB:5b2gC	0.479	0.383	4.369E-7	350	0.105	0.083	5b2gC.pdb.gz
18	PDB:6ov2A	0.518	0.755	6.483E-7	182	0.091	0.137	6ov2A.pdb.gz
19	PDB:6wxuB	0.370	0.372	2.678E-5	273	0.105	0.106	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
20	PDB:7d3eB	0.330	0.333	2.834E-5	272	0.102	0.103	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62955	0.0	571	275	1.000	1.000	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
2	P62956	0.0	571	275	1.000	1.000	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
3	P62957	0.0	571	275	1.000	1.000	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
4	Q8VHW8	3.07e-152	427	275	0.716	0.716	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
5	Q9UF02	4.21e-151	424	275	0.705	0.705	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
6	O88602	1.95e-29	115	323	0.244	0.207	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
7	Q71RJ2	1.95e-29	115	323	0.244	0.207	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
8	Q9Y698	2.37e-29	115	323	0.244	0.207	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
9	Q6PFS3	3.81e-29	114	324	0.244	0.207	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
10	Q9UBN1	3.92e-28	112	327	0.262	0.220	CCG4_HUMAN Voltage-dependent calcium channel gamma-4 subunit OS=Homo sapiens OX=9606 GN=CACNG4 PE=1 SV=1
11	Q8VHW9	4.21e-28	112	327	0.262	0.220	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
12	Q9JJV4	1.01e-27	110	327	0.258	0.217	CCG4_MOUSE Voltage-dependent calcium channel gamma-4 subunit OS=Mus musculus OX=10090 GN=Cacng4 PE=1 SV=1
13	O60359	2.96e-27	109	315	0.229	0.200	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
14	Q8VHX0	2.96e-27	109	315	0.229	0.200	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
15	Q9JJV5	2.96e-27	109	315	0.229	0.200	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
16	Q8VHW5	8.05e-26	107	421	0.236	0.154	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1
17	Q8VHW2	9.74e-26	107	423	0.236	0.154	CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit OS=Mus musculus OX=10090 GN=Cacng8 PE=1 SV=1
18	Q8WXS5	1.19e-25	106	425	0.244	0.158	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
19	Q9VRE6	5.05e-11	64.7	447	0.251	0.154	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
20	B1AQL3	3.66e-06	48.9	211	0.153	0.199	TM235_MOUSE Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07344 Amastin	26	16.1	Amastin surface glycoprotein
2	PF13903 Claudin_2	1.6e-17	75.5	PMP-22/EMP/MP20/Claudin tight junction
3	PF06653 Claudin_3	19	16.6	Tight junction protein, Claudin-like
4	PF13273 DUF4064	3.7e+02	12.8	Protein of unknown function (DUF4064)
5	PF19862 DUF6336	4.9e+02	12.4	Family of unknown function (DUF6336)
6	PF04819 DUF716	8.3	17.5	Family of unknown function (DUF716)
7	PF10242 L_HMGIC_fpl	1.2e+02	14.3	Lipoma HMGIC fusion partner-like protein
8	PF00822 PMP22_Claudin	1.3e-16	72.4	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008825951.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008850050.1	0.944	Calcium voltage-gated channel subunit alpha1 D
2	1026970.XP_008825953.1	0.943	Voltage-dependent calcium channel gamma-6 subunit isoform X1
3	1026970.XP_008827214.1	0.940	Calcium voltage-gated channel auxiliary subunit alpha2delta 1
4	1026970.XP_008827908.1	0.932	Glutamate ionotropic receptor AMPA type subunit 4
5	1026970.XP_008840549.1	0.932	Glutamate ionotropic receptor AMPA type subunit 1
6	1026970.XP_008852534.1	0.932	Glutamate ionotropic receptor AMPA type subunit 2
7	1026970.XP_008825994.1	0.929	Voltage-dependent calcium channel gamma-8 subunit
8	1026970.XP_008832143.1	0.928	Glutamate ionotropic receptor AMPA type subunit 3
9	1026970.XP_008847432.1	0.928	Calcium voltage-gated channel auxiliary subunit gamma 3
10	1026970.XP_008843442.1	0.927	Glutamate receptor ionotropic, NMDA 2D
11	1026970.XP_008841420.1	0.926	Voltage-dependent calcium channel gamma-4 subunit
12	1026970.XP_008828164.1	0.925	Glutamate ionotropic receptor NMDA type subunit 2A
13	1026970.XP_008829674.1	0.922	Glutamate receptor ionotropic, NMDA 2C
14	1026970.XP_008835410.1	0.922	Glutamate receptor ionotropic, NMDA 3B
15	1026970.XP_008835635.1	0.922	Glutamate ionotropic receptor NMDA type subunit 2B
16	1026970.XP_008837979.1	0.922	Calcium voltage-gated channel subunit alpha1 C
17	1026970.XP_008836170.1	0.921	Calcium voltage-gated channel auxiliary subunit beta 4
18	1026970.XP_008851880.1	0.921	Calcium voltage-gated channel auxiliary subunit beta 3
19	1026970.XP_008820477.1	0.920	Cornichon family AMPA receptor auxiliary protein 2
20	1026970.XP_008828504.1	0.920	Calcium voltage-gated channel subunit alpha1 S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005246	0.996	calcium channel regulator activity
GO:0005215	0.579	transporter activity
GO:0022857	0.564	transmembrane transporter activity
GO:0015075	0.547	monoatomic ion transmembrane transporter activity
GO:0005216	0.535	monoatomic ion channel activity
GO:0022890	0.507	inorganic cation transmembrane transporter activity
GO:0008324	0.499	monoatomic cation transmembrane transporter activity
GO:0022836	0.494	gated channel activity
GO:0005261	0.480	monoatomic cation channel activity
GO:0022839	0.476	monoatomic ion gated channel activity
GO:0046873	0.402	metal ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0099601	0.989	regulation of neurotransmitter receptor activity
GO:0032409	0.973	regulation of transporter activity
GO:0034762	0.926	regulation of transmembrane transport
GO:0032412	0.913	regulation of monoatomic ion transmembrane transporter activity
GO:0009987	0.871	cellular process
GO:0065008	0.437	regulation of biological quality
GO:0051179	0.404	localization
GO:0048518	0.309	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:1990351	0.998	transporter complex
GO:0030054	0.998	cell junction
GO:0045202	0.994	synapse
GO:0043226	0.993	organelle
GO:0034702	0.992	ion channel complex
GO:0098878	0.986	neurotransmitter receptor complex
GO:0098978	0.984	glutamatergic synapse
GO:0098794	0.984	postsynapse
GO:0008328	0.980	ionotropic glutamate receptor complex
GO:0097060	0.973	synaptic membrane
GO:0099572	0.916	postsynaptic specialization
GO:0098984	0.913	neuron to neuron synapse
GO:0045211	0.902	postsynaptic membrane
GO:0014069	0.890	postsynaptic density
GO:0005622	0.856	intracellular anatomical structure
GO:0005737	0.781	cytoplasm
GO:0032281	0.779	AMPA glutamate receptor complex
GO:0034703	0.753	cation channel complex
GO:0043227	0.750	membrane-bounded organelle
GO:0043229	0.696	intracellular organelle
GO:0043231	0.603	intracellular membrane-bounded organelle
GO:0012505	0.398	endomembrane system
GO:0098839	0.377	postsynaptic density membrane
GO:0036477	0.362	somatodendritic compartment
GO:0034704	0.321	calcium channel complex
GO:0042383	0.306	sarcolemma

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]