StarFunc result for job id P63000

User Input

>input (192 residues)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40792	0.989	0.989	4.305E-39	192	0.917	0.917	P40792.pdb.gz	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
2	AFDB:A2BHI1	0.978	0.858	1.517E-38	219	0.917	0.804	A2BHI1.pdb.gz
3	AFDB:A0A286QZ36	0.976	0.976	2.846E-38	192	0.880	0.880	A0A286QZ36.pdb.gz	RAC1_STIJA Ras-related protein Rac1 OS=Stichopus japonicus OX=307972 GN=RAC1 PE=2 SV=1
4	AFDB:M0R5T4	0.986	0.986	5.689E-38	192	0.917	0.917	M0R5T4.pdb.gz	M0R5T4_RAT Rac family small GTPase 3 OS=Rattus norvegicus OX=10116 GN=Rac3 PE=4 SV=3
5	AFDB:P34144	0.985	0.975	1.815E-36	194	0.828	0.820	P34144.pdb.gz	RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum OX=44689 GN=rac1A PE=1 SV=2
6	PDB:2wkpA	0.925	0.556	2.051E-35	320	0.906	0.544	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
7	AFDB:Q94124	0.938	0.924	6.566E-35	195	0.760	0.749	Q94124.pdb.gz	RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans OX=6239 GN=rac-2 PE=3 SV=1
8	AFDB:Q24814	0.937	0.918	7.448E-35	196	0.760	0.745	Q24814.pdb.gz	RACA_ENTH1 Rho-related protein racA OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=RACA PE=1 SV=1
9	AFDB:Q7JWS8	0.956	0.941	1.915E-34	195	0.708	0.697	Q7JWS8.pdb.gz	Q7JWS8_DROME AT17867p OS=Drosophila melanogaster OX=7227 GN=Mtl PE=1 SV=1
10	AFDB:A0JC80	0.932	0.900	2.463E-34	199	0.771	0.744	A0JC80.pdb.gz	A0JC80_9HYPO RacA OS=Epichloe festucae OX=35717 GN=racA PE=2 SV=1
11	AFDB:P0CY33	0.948	0.953	3.169E-34	191	0.698	0.702	P0CY33.pdb.gz	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
12	PDB:6ukaA	0.904	0.980	6.597E-29	177	0.672	0.729	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
13	PDB:1nf3A	0.917	0.908	5.975E-28	194	0.667	0.660	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
14	PDB:6jikA	0.912	0.962	1.742E-27	182	0.542	0.571	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
15	PDB:6hxuA	0.912	0.961	6.138E-27	182	0.536	0.566	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
16	PDB:4mitC	0.901	0.955	1.482E-26	181	0.521	0.552	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
17	PDB:5c2kA	0.908	0.458	1.681E-26	382	0.542	0.272	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
18	PDB:2atxA	0.892	0.921	4.057E-26	186	0.609	0.629	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
19	PDB:3a58F	0.905	0.959	3.042E-25	181	0.526	0.558	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
20	PDB:2j0vB	0.842	0.876	4.683E-23	184	0.583	0.609	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62998	8.27e-143	397	192	1.000	1.000	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1
2	P63000	8.27e-143	397	192	1.000	1.000	RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1
3	P63001	8.27e-143	397	192	1.000	1.000	RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1
4	Q6LC82	8.27e-143	397	192	1.000	1.000	Q6LC82_CHICK GTPase cRac1A OS=Gallus gallus OX=9031 GN=cRac1A PE=2 SV=1
5	Q6RUV5	8.27e-143	397	192	1.000	1.000	RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1
6	Q7ZSZ9	1.39e-141	394	192	0.984	0.984	Q7ZSZ9_DANRE Rac family small GTPase 1a OS=Danio rerio OX=7955 GN=rac1 PE=1 SV=1
7	A9JRY8	2.15e-137	383	192	0.948	0.948	A9JRY8_DANRE Rac family small GTPase 3b OS=Danio rerio OX=7955 GN=rac3b PE=1 SV=1
8	P15153	5.86e-133	372	192	0.922	0.922	RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens OX=9606 GN=RAC2 PE=1 SV=1
9	Q6IQN5	1.68e-132	370	192	0.922	0.922	Q6IQN5_DANRE Rac family small GTPase 2 OS=Danio rerio OX=7955 GN=zgc:86686 PE=1 SV=1
10	Q05144	5.74e-132	369	192	0.917	0.917	RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus OX=10090 GN=Rac2 PE=1 SV=1
11	Q5U1Y2	5.74e-132	369	192	0.917	0.917	Q5U1Y2_RAT Ras-related C3 botulinum toxin substrate 2 (Rho family, small GTP binding protein Rac2) OS=Rattus norvegicus OX=10116 GN=Rac2 PE=2 SV=1
12	P40792	3.83e-131	367	192	0.917	0.917	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
13	O93466	5.11e-129	362	192	0.896	0.896	O93466_CHICK GTPase cRac1B OS=Gallus gallus OX=9031 GN=cRac1B PE=1 SV=1
14	G1SY93	1.57e-128	361	199	0.938	0.905	G1SY93_RABIT Rac family small GTPase 1 OS=Oryctolagus cuniculus OX=9986 GN=RAC1 PE=4 SV=1
15	P48554	3.23e-128	360	192	0.896	0.896	RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster OX=7227 GN=Rac2 PE=1 SV=1
16	A0A0G2JUG6	7.51e-128	359	192	0.885	0.885	A0A0G2JUG6_RAT Rac family small GTPase 3 OS=Rattus norvegicus OX=10116 GN=Rac3 PE=4 SV=2
17	P60763	7.51e-128	359	192	0.885	0.885	RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens OX=9606 GN=RAC3 PE=1 SV=1
18	P60764	7.51e-128	359	192	0.885	0.885	RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus OX=10090 GN=Rac3 PE=1 SV=1
19	A0A286QZ36	8.96e-127	356	192	0.880	0.880	RAC1_STIJA Ras-related protein Rac1 OS=Stichopus japonicus OX=307972 GN=RAC1 PE=2 SV=1
20	A0A8I6A1P8	7.09e-125	352	208	0.870	0.803	A0A8I6A1P8_RAT Rac family small GTPase 2 OS=Rattus norvegicus OX=10116 GN=Rac2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	0.00032	31.7	ADP-ribosylation factor family
2	PF16567 CagD	1.1e+02	14.0	Pathogenicity island component CagD
3	PF00071 Ras	8.9e-52	186.4	Ras family
4	PF08477 Roc	7.7e-19	79.5	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008962197.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003813268.1	0.975	T-lymphoma invasion and metastasis-inducing protein 1 isoform X1
2	9597.XP_003819441.1	0.970	Vav guanine nucleotide exchange factor 1
3	9597.XP_008958498.1	0.969	P21 (RAC1) activated kinase 1
4	9597.XP_008966820.1	0.969	Neutrophil cytosol factor 2
5	9597.XP_003810352.1	0.960	Neutrophil cytosolic factor 1
6	9597.XP_008974298.1	0.955	Guanine nucleotide exchange factor VAV2
7	9597.XP_003815516.1	0.953	Neural Wiskott-Aldrich syndrome protein
8	9597.XP_008958107.1	0.953	IQ motif containing GTPase activating protein 1
9	9597.XP_003810964.1	0.951	Belongs to the DOCK family
10	9597.XP_003815441.1	0.951	Cytochrome b-245 heavy chain
11	9597.XP_003822283.1	0.946	Guanine nucleotide exchange factor VAV3 isoform X1
12	9597.XP_003809321.1	0.942	Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
13	9597.XP_008967637.1	0.941	Belongs to the DOCK family
14	9597.XP_003810441.1	0.940	NADPH oxidase 1 isoform X1
15	9597.XP_003812368.1	0.939	Rho guanine nucleotide exchange factor 6 isoform X1
16	9597.XP_003805807.1	0.938	Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide.
17	9597.XP_003810523.1	0.937	Rho guanine nucleotide exchange factor 28 isoform X1
18	9597.XP_008966792.1	0.937	LIM domain kinase 1
19	9597.XP_003815020.1	0.935	Engulfment and cell motility protein 1
20	9597.XP_008954771.1	0.935	BAI1 associated protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	0.998	GTPase activity
GO:0043167	0.966	ion binding
GO:1901363	0.952	heterocyclic compound binding
GO:0097159	0.952	organic cyclic compound binding
GO:0019001	0.898	guanyl nucleotide binding
GO:0032561	0.889	guanyl ribonucleotide binding
GO:0043168	0.882	anion binding
GO:0035639	0.867	purine ribonucleoside triphosphate binding
GO:0019899	0.720	enzyme binding
GO:0005525	0.710	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0032502	0.987	developmental process
GO:0050896	0.986	response to stimulus
GO:0048856	0.984	anatomical structure development
GO:0032501	0.983	multicellular organismal process
GO:0016477	0.982	cell migration
GO:0048518	0.970	positive regulation of biological process
GO:0051716	0.965	cellular response to stimulus
GO:0048522	0.955	positive regulation of cellular process
GO:0030029	0.953	actin filament-based process
GO:0040012	0.951	regulation of locomotion
GO:0016043	0.945	cellular component organization
GO:0007275	0.938	multicellular organism development
GO:0007154	0.926	cell communication
GO:0023052	0.924	signaling
GO:0051128	0.915	regulation of cellular component organization
GO:0048731	0.903	system development
GO:0044087	0.902	regulation of cellular component biogenesis
GO:2000145	0.896	regulation of cell motility
GO:0048869	0.888	cellular developmental process
GO:0040017	0.880	positive regulation of locomotion
GO:0048583	0.872	regulation of response to stimulus
GO:0006996	0.871	organelle organization
GO:0051130	0.866	positive regulation of cellular component organization
GO:0007399	0.855	nervous system development
GO:0030154	0.850	cell differentiation
GO:0030036	0.842	actin cytoskeleton organization
GO:0007165	0.819	signal transduction
GO:0030030	0.810	cell projection organization
GO:0050920	0.784	regulation of chemotaxis
GO:0031346	0.780	positive regulation of cell projection organization
GO:0009653	0.773	anatomical structure morphogenesis
GO:0120035	0.765	regulation of plasma membrane bounded cell projection organization
GO:0045785	0.753	positive regulation of cell adhesion
GO:0032879	0.752	regulation of localization
GO:0007166	0.749	cell surface receptor signaling pathway
GO:0048513	0.734	animal organ development
GO:0042221	0.731	response to chemical
GO:0023051	0.722	regulation of signaling
GO:0048468	0.720	cell development
GO:0097581	0.715	lamellipodium organization
GO:0032970	0.713	regulation of actin filament-based process
GO:0010646	0.708	regulation of cell communication
GO:0035556	0.707	intracellular signal transduction
GO:2000147	0.704	positive regulation of cell motility
GO:0030032	0.704	lamellipodium assembly
GO:0065008	0.702	regulation of biological quality
GO:0006950	0.700	response to stress
GO:1902905	0.698	positive regulation of supramolecular fiber organization
GO:0010810	0.697	regulation of cell-substrate adhesion
GO:0030334	0.696	regulation of cell migration
GO:0009888	0.689	tissue development
GO:0009605	0.684	response to external stimulus
GO:0110020	0.684	regulation of actomyosin structure organization
GO:0010811	0.682	positive regulation of cell-substrate adhesion
GO:0002685	0.681	regulation of leukocyte migration
GO:0070887	0.674	cellular response to chemical stimulus
GO:0030335	0.673	positive regulation of cell migration
GO:0009790	0.671	embryo development
GO:0048584	0.670	positive regulation of response to stimulus
GO:1902743	0.665	regulation of lamellipodium organization
GO:0007264	0.649	small GTPase mediated signal transduction
GO:0002687	0.642	positive regulation of leukocyte migration
GO:0031532	0.639	actin cytoskeleton reorganization
GO:0010591	0.639	regulation of lamellipodium assembly
GO:0002688	0.635	regulation of leukocyte chemotaxis
GO:0071622	0.634	regulation of granulocyte chemotaxis
GO:1902622	0.632	regulation of neutrophil migration
GO:0120034	0.626	positive regulation of plasma membrane bounded cell projection assembly
GO:0051049	0.624	regulation of transport
GO:1902745	0.621	positive regulation of lamellipodium organization
GO:0007417	0.620	central nervous system development
GO:0010647	0.609	positive regulation of cell communication
GO:1902624	0.608	positive regulation of neutrophil migration
GO:0002376	0.605	immune system process
GO:0060322	0.604	head development
GO:0023056	0.603	positive regulation of signaling
GO:0090022	0.601	regulation of neutrophil chemotaxis
GO:0010592	0.599	positive regulation of lamellipodium assembly
GO:0019222	0.541	regulation of metabolic process
GO:0040011	0.540	locomotion
GO:0001667	0.518	ameboidal-type cell migration
GO:0010638	0.493	positive regulation of organelle organization
GO:0009966	0.483	regulation of signal transduction
GO:0048646	0.479	anatomical structure formation involved in morphogenesis
GO:0042330	0.460	taxis
GO:0006935	0.442	chemotaxis
GO:0048519	0.419	negative regulation of biological process
GO:0051239	0.392	regulation of multicellular organismal process
GO:0060255	0.391	regulation of macromolecule metabolic process
GO:0022008	0.372	neurogenesis
GO:0048523	0.370	negative regulation of cellular process
GO:0050793	0.324	regulation of developmental process
GO:0008152	0.323	metabolic process
GO:0031323	0.313	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0071944	0.996	cell periphery
GO:0005886	0.990	plasma membrane
GO:0005829	0.982	cytosol
GO:0012505	0.977	endomembrane system
GO:0043229	0.975	intracellular organelle
GO:0043227	0.969	membrane-bounded organelle
GO:0042995	0.965	cell projection
GO:0043231	0.938	intracellular membrane-bounded organelle
GO:0043228	0.921	non-membrane-bounded organelle
GO:0043232	0.907	intracellular non-membrane-bounded organelle
GO:0030054	0.872	cell junction
GO:0045202	0.855	synapse
GO:0043005	0.821	neuron projection
GO:0005634	0.711	nucleus
GO:0031982	0.627	vesicle
GO:0032991	0.570	protein-containing complex
GO:0031090	0.365	organelle membrane
GO:0031252	0.351	cell leading edge
GO:0005856	0.312	cytoskeleton
GO:0098590	0.302	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.998	GTP + H2O = GDP + H(+) + phosphate

[back to server]