StarFunc result for job id P63096

User Input

>input (354 residues)
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RSH2	0.999	0.999	5.952E-65	354	1.000	1.000	B2RSH2.pdb.gz	GNAI1_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus OX=10090 GN=Gnai1 PE=1 SV=1
2	AFDB:G1TRG8	0.948	0.945	3.278E-57	355	0.879	0.876	G1TRG8.pdb.gz	G1TRG8_RABIT G protein subunit alpha i2 OS=Oryctolagus cuniculus OX=9986 GN=GNAI2 PE=3 SV=1
3	AFDB:P20353	0.981	0.978	4.281E-56	355	0.777	0.775	P20353.pdb.gz	GNAI_DROME G protein alpha i subunit OS=Drosophila melanogaster OX=7227 GN=Galphai PE=1 SV=2
4	AFDB:P51875	0.946	0.946	2.569E-53	354	0.701	0.701	P51875.pdb.gz	GNAO_CAEEL Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans OX=6239 GN=goa-1 PE=1 SV=3
5	AFDB:A8MTJ3	0.975	0.975	3.197E-53	354	0.684	0.684	A8MTJ3.pdb.gz	GNAT3_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Homo sapiens OX=9606 GN=GNAT3 PE=2 SV=2
6	AFDB:D3ZSS5	0.956	0.967	7.668E-53	350	0.675	0.683	D3ZSS5.pdb.gz	D3ZSS5_RAT G protein subunit alpha transducin 1 OS=Rattus norvegicus OX=10116 GN=Gnat1 PE=3 SV=1
7	AFDB:D4AA42	0.972	0.972	8.554E-53	354	0.686	0.686	D4AA42.pdb.gz	D4AA42_RAT G protein subunit alpha transducin 2 OS=Rattus norvegicus OX=10116 GN=Gnat2 PE=3 SV=1
8	AFDB:P09471	0.928	0.928	3.008E-52	354	0.723	0.723	P09471.pdb.gz	GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit alpha OS=Homo sapiens OX=9606 GN=GNAO1 PE=1 SV=4
9	AFDB:Q90WX5	0.959	0.959	1.638E-51	354	0.650	0.650	Q90WX5.pdb.gz	Q90WX5_DANRE Cone transducin alpha subunit OS=Danio rerio OX=7955 GN=gnat2 PE=1 SV=1
10	AFDB:Q9N2V6	0.966	0.958	1.828E-51	357	0.669	0.664	Q9N2V6.pdb.gz	GPA16_CAEEL Guanine nucleotide-binding protein alpha-16 subunit OS=Caenorhabditis elegans OX=6239 GN=gpa-16 PE=1 SV=3
11	PDB:3ffbA	0.840	0.908	5.937E-49	327	0.907	0.982	3ffbA.pdb.gz	Structural evidence for a sequential release mechanism for activation of heterotrimeric g proteins.
12	PDB:1gotA	0.886	0.927	1.589E-48	338	0.718	0.751	1gotA.pdb.gz	The 2.0 A crystal structure of a heterotrimeric G protein.
13	PDB:1tndA	0.887	0.971	1.398E-45	323	0.624	0.684	1tndA.pdb.gz	The 2.2 A crystal structure of transducin-alpha complexed with GTP gamma S.
14	PDB:6cmoA	0.532	0.532	9.820E-42	354	0.994	0.994	6cmoA.pdb.gz
15	PDB:3c7kC	0.856	0.972	4.511E-40	311	0.636	0.723	3c7kC.pdb.gz	Molecular architecture of G{alpha}o and the structural basis for RGS16-mediated deactivation.
16	PDB:3ah8A	0.838	0.866	8.028E-36	342	0.540	0.558	3ah8A.pdb.gz	Structural basis for the specific inhibition of heterotrimeric Gq protein by a small molecule.
17	PDB:2xtzA	0.841	0.867	7.414E-32	343	0.364	0.376	2xtzA.pdb.gz	The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
18	PDB:6eg8I	0.873	0.833	1.281E-31	372	0.415	0.395	6eg8I.pdb.gz	Structural Insights into the Process of GPCR-G Protein Complex Formation.
19	PDB:7rkfA	0.839	0.848	3.427E-31	350	0.537	0.543	7rkfA.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
20	PDB:1zcbA	0.801	0.888	6.564E-30	318	0.353	0.393	1zcbA.pdb.gz	A new approach to producing functional G alpha subunits yields the activated and deactivated structures of G alpha(12/13) proteins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A8MTJ3	530	354	0.684	0.684	GNAT3_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Homo sapiens OX=9606 GN=GNAT3 PE=2 SV=2
2	B2RSH2	736	354	1.000	1.000	GNAI1_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus OX=10090 GN=Gnai1 PE=1 SV=1
3	D3ZSS5	518	350	0.675	0.683	D3ZSS5_RAT G protein subunit alpha transducin 1 OS=Rattus norvegicus OX=10116 GN=Gnat1 PE=3 SV=1
4	D4AA42	523	354	0.686	0.686	D4AA42_RAT G protein subunit alpha transducin 2 OS=Rattus norvegicus OX=10116 GN=Gnat2 PE=3 SV=1
5	G1SEJ8	709	349	0.960	0.974	G1SEJ8_RABIT G protein subunit alpha i1 OS=Oryctolagus cuniculus OX=9986 GN=GNAI1 PE=3 SV=2
6	G1TRG8	654	355	0.879	0.876	G1TRG8_RABIT G protein subunit alpha i2 OS=Oryctolagus cuniculus OX=9986 GN=GNAI2 PE=3 SV=1
7	P04695	520	350	0.678	0.686	GNAT1_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Bos taurus OX=9913 GN=GNAT1 PE=1 SV=3
8	P04696	525	354	0.695	0.695	GNAT2_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Bos taurus OX=9913 GN=GNAT2 PE=1 SV=3
9	P04897	657	355	0.884	0.882	GNAI2_RAT Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gnai2 PE=1 SV=3
10	P04899	655	355	0.881	0.879	GNAI2_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAI2 PE=1 SV=3
11	P08752	655	355	0.881	0.879	GNAI2_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Mus musculus OX=10090 GN=Gnai2 PE=1 SV=5
12	P08753	700	354	0.935	0.935	GNAI3_RAT Guanine nucleotide-binding protein G(i) subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gnai3 PE=1 SV=3
13	P08754	700	354	0.938	0.938	GNAI3_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-3 OS=Homo sapiens OX=9606 GN=GNAI3 PE=1 SV=3
14	P09471	531	354	0.732	0.732	GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit alpha OS=Homo sapiens OX=9606 GN=GNAO1 PE=1 SV=4
15	P0C7Q4	535	354	0.692	0.692	GNAT3_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Bos taurus OX=9913 GN=GNAT3 PE=1 SV=1
16	P10824	734	354	0.997	0.997	GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Gnai1 PE=1 SV=3
17	P11488	517	350	0.678	0.686	GNAT1_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Homo sapiens OX=9606 GN=GNAT1 PE=1 SV=5
18	P18872	530	354	0.723	0.723	GNAO_MOUSE Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3
19	P19087	525	354	0.695	0.695	GNAT2_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAT2 PE=1 SV=4
20	P20353	584	355	0.780	0.777	GNAI_DROME G protein alpha i subunit OS=Drosophila melanogaster OX=7227 GN=Galphai PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.1e+02	13.1	AAA ATPase domain
2	PF13555 AAA_29	2.4e+02	12.9	P-loop containing region of AAA domain
3	PF00025 Arf	1.7e-14	65.2	ADP-ribosylation factor family
4	PF03196 DUF261	1e+02	14.4	Protein of unknown function, DUF261
5	PF01580 FtsK_SpoIIIE	4.6e+02	11.5	FtsK/SpoIIIE family
6	PF00503 G-alpha	2.9e-122	419.9	G-protein alpha subunit
7	PF04670 Gtr1_RagA	0.056	24.4	Gtr1/RagA G protein conserved region
8	PF00071 Ras	2.5e+02	12.6	Ras family
9	PF08477 Roc	0.8	21.4	Ras of Complex, Roc, domain of DAPkinase
10	PF05621 TniB	1.6e+02	13.1	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000000666

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000006826	0.985	Guanine nucleotide binding protein (G protein), beta polypeptide 1
2	132908.ENSPVAP00000010688	0.980	Rap guanine nucleotide exchange factor (GEF) 4
3	132908.ENSPVAP00000008667	0.914	Regulator of G-protein signaling 9
4	132908.ENSPVAP00000002772	0.909	Cannabinoid receptor 1 (brain)
5	132908.ENSPVAP00000012629	0.908	Guanine nucleotide binding protein (G protein), gamma 2
6	132908.ENSPVAP00000001259	0.905	G-protein signaling modulator 1
7	132908.ENSPVAP00000010180	0.904	Guanine nucleotide binding protein (G protein), beta polypeptide 4
8	132908.ENSPVAP00000011327	0.904	Guanine nucleotide binding protein (G protein), beta polypeptide 2
9	132908.ENSPVAP00000015948	0.898	Relaxin/insulin-like family peptide receptor 1
10	132908.ENSPVAP00000009950	0.874	Mitogen-activated protein kinase 3
11	132908.ENSPVAP00000016124	0.874	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
12	132908.ENSPVAP00000005341	0.873	Sphingosine-1-phosphate receptor 1
13	132908.ENSPVAP00000009249	0.864	Adenylate cyclase 6
14	132908.ENSPVAP00000016841	0.864	Adenylate cyclase 5
15	132908.ENSPVAP00000016251	0.858	Opioid receptor, delta 1
16	132908.ENSPVAP00000003777	0.857	Guanine nucleotide binding protein (G protein), beta 5
17	132908.ENSPVAP00000016419	0.855	Adrenoceptor beta 2, surface
18	132908.ENSPVAP00000002250	0.854	Corticotropin releasing hormone receptor 1
19	132908.ENSPVAP00000016986	0.854	Regulator of G-protein signaling 14
20	132908.ENSPVAP00000014268	0.852	Lysophosphatidic acid receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043168	0.999	anion binding
GO:0003924	0.999	GTPase activity
GO:0019001	0.999	guanyl nucleotide binding
GO:0032553	0.996	ribonucleotide binding
GO:0005525	0.989	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0007165	0.990	signal transduction
GO:0007186	0.973	G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005737	0.997	cytoplasm
GO:0043229	0.986	intracellular organelle
GO:0005829	0.950	cytosol
GO:0043227	0.938	membrane-bounded organelle
GO:0012505	0.929	endomembrane system
GO:0043231	0.910	intracellular membrane-bounded organelle
GO:0032991	0.864	protein-containing complex
GO:0031982	0.704	vesicle
GO:0005634	0.434	nucleus
GO:0043228	0.426	non-membrane-bounded organelle
GO:0043232	0.412	intracellular non-membrane-bounded organelle
GO:0005856	0.362	cytoskeleton
GO:0098552	0.349	side of membrane
GO:0098797	0.330	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.999	GTP + H2O = GDP + H(+) + phosphate

[back to server]