StarFunc result for job id P63128

User Input

>input (1117 residues)
MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDW
KRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEEDSISVSDAPGSGIIDCNEKTR
KKSQKETESLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPSESKPRG
TSPLPAGQVPVTLQPQKQVKENKTQPPVAYQYWPPAELQYRPPPESQYGYPGMPPAPQGR
APYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQEGEP
PTVEARYKSFSIKILKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDWEILAKSSLSP
SQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVR
AICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVIVELMA
YENANPECQSAIKPLKGKVPAGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVR
TFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFD
KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNNCPPP
QVAVQQVDLCTIQAVSLLPGEPPQKIPTGVYGPLPEGTVGLILGRSSLNLKGVQIHTSVV
DSDYKGEIQLVISSSVPWSASPGDRIAQLLLLPYIKGGNSEIKRIGGLGSTDPTGKAAYW
ASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEV
YQSMEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMTK
RGYIPGKGLGKNEDGIKIPFEAKINQKREGIGYPFLGAATIEPPKPIPLTWKTEKPVWVN
QWPLPKQKLEALHLLANEQLEKGHIEPSFSPWNSPVFVIQKKSGKWRMLTDLRAVNAVIQ
PMGPLQPGLPSPAMIPKDWPLIIIDLKDCFFTIPLAEQDCEKFAFTIPAINNKEPATRFQ
WKVLPQGMLNSPTICQTFVGRALQPVKVFRLLYYSLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2jleA	0.147	0.296	2.854E-12	545	0.057	0.117	2jleA.pdb.gz	Novel Indazole Non-Nucleoside Reverse Transcriptase Inhibitors Using Molecular Hybridization Based on Crystallographic Overlays.
2	PDB:6t61A	0.093	0.393	1.095E-7	217	0.038	0.198	6t61A.pdb.gz
3	PDB:3gv2A	0.152	0.647	1.155E-7	219	0.038	0.192	3gv2A.pdb.gz
4	PDB:4gcyA	0.079	0.508	1.595E-6	163	0.032	0.221	4gcyA.pdb.gz	RAMD identification of substrate binding pathways to the active site of dUTPase
5	PDB:2avoA	0.083	0.768	3.759E-6	99	0.025	0.283	2avoA.pdb.gz	Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S.
6	PDB:6hdeB	0.077	0.522	4.184E-6	152	0.030	0.217	6hdeB.pdb.gz	The Role of a Key Amino Acid Position in Species-Specific Proteinaceous dUTPase Inhibition.
7	PDB:3f4fA	0.080	0.586	1.158E-5	138	0.029	0.232	3f4fA.pdb.gz	Structure and activity of the Saccharomyces cerevisiae dUTP pyrophosphatase DUT1, an essential housekeeping enzyme.
8	PDB:4ao5B	0.081	0.636	1.158E-5	129	0.025	0.217	4ao5B.pdb.gz	Tying Down the Arm in Bacillus Dutpase: Structure and Mechanism
9	PDB:4oopB	0.083	0.585	3.971E-5	142	0.028	0.218	4oopB.pdb.gz	Structural insights into the mechanism defining substrate affinity in Arabidopsis thaliana dUTPase: the role of tryptophan 93 in ligand orientation.
10	AFDB:Q9ESJ4	0.070	0.095	2.264E-4	714	0.064	0.101	Q9ESJ4.pdb.gz	SPN90_MOUSE NCK-interacting protein with SH3 domain OS=Mus musculus OX=10090 GN=Nckipsd PE=1 SV=2
11	PDB:4a6aA	0.073	0.400	3.041E-4	189	0.029	0.169	4a6aA.pdb.gz	Dttp Inhibition of the Bifunctional Dctp Deaminase- Dutpase from Mycobacterium Tuberculosis is Ph Dependent: Kinetic Analyses and Crystal Structure of A115V Variant
12	AFDB:Q9NZQ3	0.062	0.085	2.964E-3	722	0.059	0.091	Q9NZQ3.pdb.gz	SPN90_HUMAN NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD PE=1 SV=1
13	AFDB:Q9QY23	0.062	0.078	9.632E-3	797	0.056	0.078	Q9QY23.pdb.gz	PKP3_MOUSE Plakophilin-3 OS=Mus musculus OX=10090 GN=Pkp3 PE=1 SV=2
14	AFDB:Q7Z5K2	0.051	0.050	1.401E-2	1190	0.073	0.068	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
15	AFDB:Q9DB00	0.049	0.031	3.485E-2	2260	0.109	0.054	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
16	AFDB:Q10496	0.048	0.051	5.349E-2	1031	0.063	0.068	Q10496.pdb.gz	GYP51_SCHPO GTPase activating protein Gyp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp51 PE=3 SV=1
17	AFDB:Q9UFD9	0.048	0.036	7.378E-2	1639	0.125	0.085	Q9UFD9.pdb.gz	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
18	AFDB:P46678	0.042	0.068	1.073E-1	594	0.059	0.111	P46678.pdb.gz	TFC5_YEAST Transcription factor TFIIIB component B'' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDP1 PE=1 SV=1
19	AFDB:A0A0K3AU72	0.058	0.046	1.133E-1	1698	0.068	0.045	A0A0K3AU72.pdb.gz	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
20	AFDB:Q6ZNL6	0.052	0.044	1.133E-1	1462	0.102	0.078	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10271	6.99e-91	313	860	0.234	0.303	PRO_MMTVB Gag-Pro polyprotein OS=Mouse mammary tumor virus (strain BR6) OX=11758 GN=gag-pro PE=1 SV=2
2	O92956	1.29e-62	236	1603	0.120	0.084	POL_RSVSB Gag-Pol polyprotein OS=Rous sarcoma virus subgroup B (strain Schmidt-Ruppin) OX=269447 GN=gag-pol PE=1 SV=2
3	P03354	2.80e-62	235	1603	0.119	0.083	POL_RSVP Gag-Pol polyprotein OS=Rous sarcoma virus subgroup C (strain Prague) OX=11888 GN=gag-pol PE=1 SV=2
4	P07567	1.43e-52	198	657	0.109	0.186	GAG_MPMV Gag polyprotein OS=Mason-Pfizer monkey virus OX=11855 GN=gag PE=1 SV=3
5	P11204	2.42e-34	145	1146	0.089	0.086	POL_EIAV9 Pol polyprotein OS=Equine infectious anemia virus (isolate 1369) OX=11670 GN=pol PE=1 SV=1
6	P03363	2.82e-27	122	1461	0.062	0.047	POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 OX=11909 GN=gag-pro-pol PE=1 SV=4
7	P03366	6.73e-27	121	1447	0.092	0.071	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
8	P04585	1.20e-26	120	1435	0.091	0.071	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
9	P35963	1.86e-26	120	1435	0.056	0.044	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
10	Q72547	1.99e-26	117	566	0.056	0.110	Q72547_9HIV1 Reverse transcriptase/RNaseH (Fragment) OS=Human immunodeficiency virus 1 OX=11676 GN=pol PE=1 SV=1
11	P12497	1.15e-25	117	1435	0.091	0.071	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
12	P69730	2.56e-19	95.1	486	0.057	0.132	GAG_EIAV9 Gag polyprotein OS=Equine infectious anemia virus (isolate 1369) OX=11670 GN=gag PE=1 SV=1
13	P05888	4.21e-16	85.1	507	0.053	0.116	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
14	P03348	4.61e-16	85.1	512	0.044	0.096	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
15	Q79791	8.45e-16	84.0	500	0.045	0.100	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
16	P04591	1.14e-15	83.6	500	0.044	0.098	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
17	Q77YG1	1.14e-15	83.6	500	0.044	0.098	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
18	P03347	1.33e-15	83.6	512	0.044	0.096	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
19	Q72497	2.32e-15	82.8	500	0.044	0.098	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
20	P04590	3.19e-11	69.7	522	0.041	0.088	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12511 DUF3716	8.8e+02	11.4	Protein of unknown function (DUF3716)
2	PF00692 dUTPase	1.1e-12	59.2	dUTPase
3	PF01585 G-patch	4.2e-10	50.7	G-patch domain
4	PF13975 gag-asp_proteas	5.1e+02	12.6	gag-polyprotein putative aspartyl protease
5	PF02337 Gag_p10	3.2e-27	105.6	Retroviral GAG p10 protein
6	PF00607 Gag_p24	1.1e-37	140.2	gag protein p24 N-terminal domain
7	PF19317 Gag_p24_C	1.2e-27	106.8	Gag protein p24 C-terminal domain
8	PF00077 RVP	9.2e-30	114.3	Retroviral aspartyl protease
9	PF00078 RVT_1	1.9e-18	78.4	Reverse transcriptase (RNA-dependent DNA polymerase)
10	PF00098 zf-CCHC	0.004	28.4	Zinc knuckle
11	PF14392 zf-CCHC_4	3.6e+02	12.2	Zinc knuckle
12	PF14787 zf-CCHC_5	3.3e-18	76.4	GAG-polyprotein viral zinc-finger
13	PF15288 zf-CCHC_6	56	15.0	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9978.XP_004580917.1

Rank	PPI partner	STRING score	Description
1	9978.XP_004584002.1	0.946	Corticosteroid 11-beta-dehydrogenase isozyme 2
2	9978.XP_004591918.1	0.945	Testosterone 17-beta-dehydrogenase 3
3	9978.XP_004580289.1	0.939	Steroid 17-alpha-hydroxylase/17,20 lyase-like
4	9978.XP_004598819.1	0.937	Steroid 21-hydroxylase-like
5	9978.XP_004578739.1	0.936	Corticosteroid 11-beta-dehydrogenase isozyme 1
6	9978.XP_004578134.1	0.934	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 4 Proteins
7	9978.XP_004597951.1	0.930	3-oxo-5-alpha-steroid 4-dehydrogenase 1
8	9978.XP_004582772.1	0.924	3-oxo-5-alpha-steroid 4-dehydrogenase 2
9	9978.XP_004590927.1	0.914	Polyprenol reductase isoform X1
10	9978.XP_004590320.1	0.910	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 9 Proteins
11	9978.XP_004588603.1	0.900	Aldo-keto reductase family 1 member C1 homolog
12	9978.XP_004585270.1	0.887	Adrenodoxin-like
13	9978.XP_004581915.1	0.850	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase-like isoform X1
14	9978.XP_004581917.1	0.850	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins
15	9978.XP_004598566.1	0.785	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 10 Proteins
16	9978.XP_004584270.1	0.766	Estradiol 17-beta-dehydrogenase 2
17	9978.XP_004599780.1	0.766	Estradiol 17-beta-dehydrogenase 2-like
18	9978.XP_004588156.1	0.743	25-hydroxycholesterol 7-alpha-hydroxylase-like
19	9978.XP_004594430.1	0.731	3-oxo-5-beta-steroid 4-dehydrogenase-like isoform X1
20	9978.XP_004594433.1	0.731	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 22 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.997	binding
GO:0016787	0.986	hydrolase activity
GO:0004175	0.969	endopeptidase activity
GO:0005515	0.938	protein binding
GO:0070001	0.805	aspartic-type peptidase activity
GO:0004190	0.679	aspartic-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.595	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.862	intracellular anatomical structure
GO:0005737	0.776	cytoplasm
GO:0043231	0.533	intracellular membrane-bounded organelle
GO:0043233	0.304	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.986	Hydrolases.
EC:3.4.-.-	0.971	Acting on peptide bonds (peptidases).
EC:3.4.23.-	0.679	Aspartic endopeptidases.

[back to server]