StarFunc result for job id P63133

User Input

>input (956 residues)
NKSKKRRNRVSFLGVATIEPPKPIPLTWKTEKLVWVNQWPLPKQKLEALHLLANEQLEKG
HIEPSFSPWNSPVFVIQKKSGKWRMLTDLRAVNAVIQPMGPLQPGLPSPAMIPKDWPLII
IDLKDCFFTIPLAEQDCEKFAFTIPAINNKEPATRFQWKVLPQGMLNSPTICQTFVGRAL
QPVRKKFSDCYIIHYIDDILCAAETKDKLIDCYTFLQAEVASAGLAIASDKIQTSTPFHY
LGMQIENRKIKPQKIEIRKDTLKTLNDFQKLLGDINWIQPTLGIPTYAMSNLFSILRGDS
DLNSKRILTPEATKEIKLVEEKIQSAQINRIDPLAPLQLLIFATAHSPTGIIIQNTDLVE
WSFLPHSTVKTFTLYLDQIATLIGQTRLRIIKLCGNDPDKIVVPLTKEQVRQAFINSGAW
QIGLANFVGIIDNHYPKTKIFQFLKLTTWILPKITRREPLENALTVFTDGSSNGKAAYTG
PKERVIKTPYQSAQRAELVAVITVLQDFDQPINIISDSAYVVQATRVVETALIKYSMDDQ
LNQLFNLLQQTVRKRNFPFYITHIRAHTNLPGPLTKANEQADLLVSSALIKAQELHALTH
VNAAGLKNKFDVTWKQAKDIVQHCTQCQVLHLPTQEAGVNPRGLCPNALWQMDVTHVPSF
GRLSYVHVTVDTYSHFIWATCQTGESTSHVKKHLLSCFAVMGVPEKIKTDNGPGYCSKAF
QKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQLVKQKEGGDSKECTTPQMQLNLALY
TLNFLNIYRNQTTTSAEQHLTGKKNSPHEGKLIWWKDNKNKTWEIGKVITWGRGFACVSP
GENQLPVWIPTRHLKFYNEPIRDAKKSTSAETETPQSSTVDSQDEQNGDVRRTDEVAIHQ
EGRAADLGTTKEADAVSYKISREHKGDTNPREYAACSLDDCINGGKSPYACRSSCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2jleA	0.479	0.802	8.041E-38	545	0.159	0.279	2jleA.pdb.gz	Novel Indazole Non-Nucleoside Reverse Transcriptase Inhibitors Using Molecular Hybridization Based on Crystallographic Overlays.
2	AFDB:P0CT40	0.405	0.298	5.736E-37	1333	0.167	0.120	P0CT40.pdb.gz	TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1
3	AFDB:Q99315	0.223	0.144	1.896E-30	1547	0.146	0.090	Q99315.pdb.gz	YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3
4	AFDB:Q7LHG5	0.225	0.150	3.625E-30	1498	0.145	0.093	Q7LHG5.pdb.gz	YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2
5	AFDB:P47024	0.175	0.097	4.533E-10	1803	0.050	0.027	P47024.pdb.gz	YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY4B-J PE=3 SV=3
6	PDB:7q5bB	0.146	0.269	1.878E-7	482	0.052	0.104	7q5bB.pdb.gz	Structural basis of Ty3 retrotransposon integration at RNA Polymerase III-transcribed genes.
7	PDB:6vrdA	0.105	0.581	1.292E-4	149	0.035	0.221	6vrdA.pdb.gz	Crystal structure of RNase H/RNA/PS-ASO complex at an atomic level
8	PDB:7lmaA	0.174	0.165	1.390E-3	1012	0.048	0.045	7lmaA.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
9	PDB:7qxaA	0.151	0.151	1.467E-3	954	0.039	0.039	7qxaA.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
10	PDB:7x3kB	0.073	0.122	3.125E-3	506	0.062	0.117	7x3kB.pdb.gz
11	PDB:5eq6A	0.070	0.147	3.298E-3	357	0.037	0.098	5eq6A.pdb.gz	PilN Binding Modulates the Structure and Binding Partners of the Pseudomonas aeruginosa Type IVa Pilus Protein PilM.
12	PDB:7kpvD	0.073	0.079	5.080E-3	876	0.083	0.090	7kpvD.pdb.gz
13	PDB:1rddA	0.098	0.466	5.362E-3	155	0.029	0.181	1rddA.pdb.gz	Crystal structure of Escherichia coli RNase HI in complex with Mg2+ at 2.8 A resolution: proof for a single Mg(2+)-binding site.
14	PDB:6x5hA	0.069	0.117	8.259E-3	467	0.033	0.069	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
15	AFDB:Q09633	0.106	0.188	1.231E-2	507	0.036	0.067	Q09633.pdb.gz	Q09633_CAEEL RNase H type-1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rnh-1.1 PE=4 SV=3
16	AFDB:Q6TLK4	0.056	0.060	9.578E-2	869	0.026	0.029	Q6TLK4.pdb.gz	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
17	AFDB:Q2US45	0.052	0.040	1.398E-1	1261	0.020	0.015	Q2US45.pdb.gz	MYO1_ASPOR Myosin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=myoA PE=3 SV=1
18	AFDB:O35876	0.056	0.169	1.475E-1	289	0.019	0.062	O35876.pdb.gz	SMN_RAT Survival motor neuron protein OS=Rattus norvegicus OX=10116 GN=Smn1 PE=1 SV=1
19	AFDB:Q00647	0.046	0.036	1.475E-1	1249	0.023	0.018	Q00647.pdb.gz	MYO1_EMENI Myosin-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=myoA PE=1 SV=2
20	AFDB:O94868	0.052	0.063	2.272E-1	740	0.074	0.096	O94868.pdb.gz	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P03354	1.83e-150	487	1603	0.331	0.197	POL_RSVP Gag-Pol polyprotein OS=Rous sarcoma virus subgroup C (strain Prague) OX=11888 GN=gag-pol PE=1 SV=2
2	O92956	7.66e-150	485	1603	0.325	0.194	POL_RSVSB Gag-Pol polyprotein OS=Rous sarcoma virus subgroup B (strain Schmidt-Ruppin) OX=269447 GN=gag-pol PE=1 SV=2
3	P03363	4.69e-96	333	1461	0.295	0.193	POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 OX=11909 GN=gag-pro-pol PE=1 SV=4
4	P03366	1.83e-66	246	1447	0.253	0.167	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
5	P04585	3.37e-66	245	1435	0.252	0.168	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
6	P35963	2.06e-65	243	1435	0.234	0.156	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
7	P12497	3.82e-63	236	1435	0.229	0.153	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
8	P11204	1.54e-57	218	1146	0.165	0.138	POL_EIAV9 Pol polyprotein OS=Equine infectious anemia virus (isolate 1369) OX=11670 GN=pol PE=1 SV=1
9	Q72547	2.23e-50	189	566	0.178	0.300	Q72547_9HIV1 Reverse transcriptase/RNaseH (Fragment) OS=Human immunodeficiency virus 1 OX=11676 GN=pol PE=1 SV=1
10	A1Z651	8.26e-17	88.6	1733	0.152	0.084	POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) OX=373193 GN=gag-pol PE=1 SV=1
11	P03355	5.26e-16	85.9	1738	0.094	0.052	POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) OX=928306 GN=gag-pol PE=1 SV=5
12	Q8UN00	8.18e-16	85.1	1738	0.084	0.046	Q8UN00_MLVMO Gag-Pol polyprotein OS=Moloney murine leukemia virus OX=11801 GN=gag-pro-pol PE=1 SV=1
13	P0CT40	7.93e-13	75.5	1333	0.075	0.054	TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1
14	Q7LHG5	3.03e-12	73.6	1498	0.071	0.045	YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2
15	Q99315	3.38e-12	73.2	1547	0.071	0.044	YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3
16	Q76353	8.54e-11	66.2	288	0.052	0.174	Q76353_9HIV1 Integrase (Fragment) OS=Human immunodeficiency virus 1 OX=11676 PE=1 SV=1
17	P14350	2.15e-09	63.9	1143	0.085	0.071	POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus OX=11963 GN=pol PE=1 SV=2
18	P37007	6.50e-08	58.2	384	0.048	0.120	YAGA_ECOLI Uncharacterized protein YagA OS=Escherichia coli (strain K12) OX=83333 GN=yagA PE=2 SV=3
19	P9WKH9	0.002	43.5	278	0.038	0.129	TRA9_MYCTU Putative transposase for insertion sequence element IS986/IS6110 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0796 PE=4 SV=1
20	Q09633	0.004	43.1	507	0.047	0.089	Q09633_CAEEL RNase H type-1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rnh-1.1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13610 DDE_Tnp_IS240	16	17.1	DDE domain
2	PF02022 Integrase_Zn	3.3e-14	63.9	Integrase Zinc binding domain
3	PF00552 IN_DBD_C	0.0004	30.9	Integrase DNA binding domain
4	PF00075 RNase_H	5.3e-19	80.3	RNase H
5	PF00665 rve	1.6e-19	81.4	Integrase core domain
6	PF00078 RVT_1	4.4e-35	132.8	Reverse transcriptase (RNA-dependent DNA polymerase)
7	PF06817 RVT_thumb	2.3e-28	109.1	Reverse transcriptase thumb domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9978.XP_004580917.1

Rank	PPI partner	STRING score	Description
1	9978.XP_004584002.1	0.946	Corticosteroid 11-beta-dehydrogenase isozyme 2
2	9978.XP_004591918.1	0.945	Testosterone 17-beta-dehydrogenase 3
3	9978.XP_004580289.1	0.939	Steroid 17-alpha-hydroxylase/17,20 lyase-like
4	9978.XP_004598819.1	0.937	Steroid 21-hydroxylase-like
5	9978.XP_004578739.1	0.936	Corticosteroid 11-beta-dehydrogenase isozyme 1
6	9978.XP_004578134.1	0.934	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 4 Proteins
7	9978.XP_004597951.1	0.930	3-oxo-5-alpha-steroid 4-dehydrogenase 1
8	9978.XP_004582772.1	0.924	3-oxo-5-alpha-steroid 4-dehydrogenase 2
9	9978.XP_004590927.1	0.914	Polyprenol reductase isoform X1
10	9978.XP_004590320.1	0.910	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 9 Proteins
11	9978.XP_004588603.1	0.900	Aldo-keto reductase family 1 member C1 homolog
12	9978.XP_004585270.1	0.887	Adrenodoxin-like
13	9978.XP_004581915.1	0.850	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase-like isoform X1
14	9978.XP_004581917.1	0.850	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins
15	9978.XP_004598566.1	0.785	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 10 Proteins
16	9978.XP_004584270.1	0.766	Estradiol 17-beta-dehydrogenase 2
17	9978.XP_004599780.1	0.766	Estradiol 17-beta-dehydrogenase 2-like
18	9978.XP_004588156.1	0.743	25-hydroxycholesterol 7-alpha-hydroxylase-like
19	9978.XP_004594430.1	0.731	3-oxo-5-beta-steroid 4-dehydrogenase-like isoform X1
20	9978.XP_004594433.1	0.731	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 22 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.908	identical protein binding
GO:0003824	0.379	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0046483	0.986	heterocycle metabolic process
GO:1901360	0.984	organic cyclic compound metabolic process
GO:0006725	0.984	cellular aromatic compound metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0034641	0.960	cellular nitrogen compound metabolic process
GO:0006139	0.950	nucleobase-containing compound metabolic process
GO:0034654	0.574	nucleobase-containing compound biosynthetic process
GO:0006259	0.433	DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005622	0.988	intracellular anatomical structure
GO:0043229	0.906	intracellular organelle
GO:0043231	0.902	intracellular membrane-bounded organelle
GO:0005634	0.842	nucleus
GO:0005737	0.529	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]