StarFunc result for job id P63146

User Input

>input (152 residues)
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49459	0.997	0.997	1.086E-32	152	0.954	0.954	P49459.pdb.gz	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
2	AFDB:P25153	0.991	0.997	1.661E-30	151	0.855	0.861	P25153.pdb.gz	UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc6 PE=2 SV=2
3	AFDB:P52478	0.985	0.780	3.165E-30	192	0.829	0.656	P52478.pdb.gz	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
4	PDB:6cyrA	0.976	0.970	4.310E-30	153	0.947	0.941	6cyrA.pdb.gz
5	AFDB:P25865	0.996	0.996	1.010E-29	152	0.750	0.750	P25865.pdb.gz	UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana OX=3702 GN=UBC1 PE=1 SV=1
6	AFDB:P42746	0.977	0.990	6.993E-29	150	0.704	0.713	P42746.pdb.gz	UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana OX=3702 GN=UBC3 PE=2 SV=1
7	AFDB:P23566	0.984	0.990	8.648E-28	151	0.704	0.709	P23566.pdb.gz	UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp6 PE=1 SV=3
8	AFDB:O74201	0.990	0.841	4.336E-27	179	0.697	0.592	O74201.pdb.gz	UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBC2 PE=2 SV=1
9	AFDB:P06104	0.988	0.873	9.400E-27	172	0.691	0.610	P06104.pdb.gz	UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD6 PE=1 SV=1
10	PDB:2aakA	0.967	0.980	2.011E-26	150	0.750	0.760	2aakA.pdb.gz
11	PDB:7meyB	0.936	0.930	4.703E-22	153	0.678	0.673	7meyB.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
12	AFDB:O00102	0.922	0.846	1.303E-19	166	0.395	0.361	O00102.pdb.gz	UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2
13	AFDB:Q9N9Z5	0.958	0.732	1.798E-19	200	0.421	0.320	Q9N9Z5.pdb.gz	Q9N9Z5_DROME Ubiquitin conjugating enzyme OS=Drosophila melanogaster OX=7227 GN=Ubc7 PE=2 SV=1
14	PDB:4m1nC	0.891	0.849	2.496E-18	160	0.401	0.381	4m1nC.pdb.gz
15	PDB:2cyxA	0.929	0.838	6.566E-18	169	0.408	0.367	2cyxA.pdb.gz
16	PDB:3ptfA	0.893	0.887	1.031E-17	153	0.362	0.359	3ptfA.pdb.gz
17	PDB:2pe6A	0.888	0.840	2.236E-17	161	0.401	0.379	2pe6A.pdb.gz
18	PDB:3rczB	0.882	0.866	2.236E-17	155	0.401	0.394	3rczB.pdb.gz
19	PDB:6op8A	0.920	0.840	2.385E-17	167	0.395	0.359	6op8A.pdb.gz
20	PDB:5aieB	0.920	0.932	3.087E-17	150	0.349	0.353	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P63146	6.16e-112	315	152	1.000	1.000	UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1
2	P63147	6.16e-112	315	152	1.000	1.000	UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus OX=10090 GN=Ube2b PE=1 SV=1
3	P63149	6.16e-112	315	152	1.000	1.000	UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus OX=10116 GN=Ube2b PE=2 SV=1
4	P49459	3.52e-107	303	152	0.954	0.954	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
5	Q9Z255	3.52e-107	303	152	0.954	0.954	UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus OX=10090 GN=Ube2a PE=1 SV=1
6	P25153	7.98e-97	277	151	0.855	0.861	UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc6 PE=2 SV=2
7	P52478	2.19e-96	278	192	0.829	0.656	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
8	P25865	8.80e-88	254	152	0.750	0.750	UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana OX=3702 GN=UBC1 PE=1 SV=1
9	P42745	3.01e-87	253	152	0.743	0.743	UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana OX=3702 GN=UBC2 PE=2 SV=1
10	P42746	2.85e-83	243	150	0.704	0.713	UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana OX=3702 GN=UBC3 PE=2 SV=1
11	P23566	1.80e-81	238	151	0.704	0.709	UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp6 PE=1 SV=3
12	O74201	5.76e-79	233	179	0.691	0.587	UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBC2 PE=2 SV=1
13	P06104	1.59e-78	232	172	0.684	0.605	UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD6 PE=1 SV=1
14	Q9FKT3	6.34e-43	140	148	0.414	0.426	UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1
15	Q9SLE4	1.30e-42	140	148	0.395	0.405	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
16	P35133	1.73e-42	139	148	0.388	0.399	UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana OX=3702 GN=UBC10 PE=1 SV=1
17	Q8S920	5.51e-42	138	147	0.382	0.395	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
18	P35131	5.68e-42	138	148	0.382	0.392	UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana OX=3702 GN=UBC8 PE=1 SV=1
19	F4JKF3	5.74e-42	139	178	0.388	0.331	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
20	Q84K93	7.71e-42	138	148	0.382	0.392	Q84K93_GOSHI Ubiquitin-conjugating enzyme E2 OS=Gossypium hirsutum OX=3635 GN=UBC2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	4.1	19.1	RWD domain
2	PF05743 UEV	1.5e+02	13.6	UEV domain
3	PF00179 UQ_con	3.7e-50	180.7	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008826147.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008853033.1	0.995	E3 ubiquitin-protein ligase RAD18
2	1026970.XP_008822056.1	0.965	Ring finger protein 40
3	1026970.XP_008822307.1	0.960	Ubiquitin like modifier activating enzyme 1
4	1026970.XP_008842255.1	0.941	Ubiquitin-conjugating enzyme E2 A isoform X1
5	1026970.XP_008822026.1	0.911	Ubiquitin conjugating enzyme E2 N
6	1026970.XP_008843971.1	0.911	Ubiquitin-conjugating enzyme E2 N-like
7	1026970.XP_008845061.1	0.904	Ubiquitin protein ligase E3 component n-recognin 1
8	1026970.XP_008852047.1	0.903	Ubiquitin like modifier activating enzyme 6
9	1026970.XP_008833979.1	0.866	Ubiquitin protein ligase E3 component n-recognin 2
10	1026970.XP_008845815.1	0.866	E3 ubiquitin-protein ligase UBR2-like
11	1026970.XP_008821230.1	0.852	Ribosomal protein S27a
12	1026970.XP_008829199.1	0.850	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
13	1026970.XP_008844352.1	0.850	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
14	1026970.XP_008849202.1	0.850	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
15	1026970.XP_008850141.1	0.850	Ring finger protein 20
16	1026970.XP_008850920.1	0.850	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
17	1026970.XP_008851640.1	0.850	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
18	1026970.XP_008834124.1	0.849	Proliferating cell nuclear antigen
19	1026970.XP_008851389.1	0.842	Ubiquitin like modifier activating enzyme 7
20	1026970.XP_008845018.1	0.832	RTF1 homolog, Paf1/RNA polymerase II complex component

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0031625	0.999	ubiquitin protein ligase binding
GO:0061650	0.986	ubiquitin-like protein conjugating enzyme activity
GO:0061631	0.970	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0009987	0.983	cellular process
GO:0019538	0.959	protein metabolic process
GO:0044237	0.849	cellular metabolic process
GO:0044260	0.739	cellular macromolecule metabolic process
GO:0070647	0.736	protein modification by small protein conjugation or removal
GO:0032446	0.730	protein modification by small protein conjugation
GO:0050789	0.690	regulation of biological process
GO:0050896	0.666	response to stimulus
GO:0050794	0.560	regulation of cellular process
GO:0051716	0.412	cellular response to stimulus
GO:0006950	0.401	response to stress
GO:0030163	0.396	protein catabolic process
GO:0051603	0.394	proteolysis involved in protein catabolic process
GO:0016567	0.389	protein ubiquitination
GO:0043632	0.383	modification-dependent macromolecule catabolic process
GO:0019941	0.373	modification-dependent protein catabolic process
GO:0048518	0.326	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005694	0.998	chromosome
GO:0070013	0.997	intracellular organelle lumen
GO:0031981	0.994	nuclear lumen
GO:0032991	0.973	protein-containing complex
GO:0005654	0.968	nucleoplasm
GO:0005829	0.960	cytosol
GO:0140535	0.957	intracellular protein-containing complex
GO:1902494	0.945	catalytic complex
GO:1990234	0.927	transferase complex
GO:0000785	0.848	chromatin
GO:0031371	0.807	ubiquitin conjugating enzyme complex
GO:0000803	0.691	sex chromosome
GO:0001741	0.681	XY body
GO:0000151	0.379	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.970	E2 ubiquitin-conjugating enzyme.

[back to server]