StarFunc result for job id P63151

User Input

>input (447 residues)
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2BG80	0.982	0.980	2.685E-80	448	0.928	0.926	A2BG80.pdb.gz	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
2	AFDB:P56932	0.969	0.957	6.845E-80	453	0.897	0.885	P56932.pdb.gz	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
3	AFDB:P36877	0.949	0.957	6.648E-78	443	0.846	0.853	P36877.pdb.gz	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
4	PDB:3dw8E	0.929	0.986	9.339E-76	421	0.940	0.998	3dw8E.pdb.gz	Structure of a protein phosphatase 2A holoenzyme: insights into B55-mediated Tau dephosphorylation.
5	AFDB:Q9Y2T4	0.945	0.945	2.369E-75	447	0.803	0.803	Q9Y2T4.pdb.gz	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
6	AFDB:X1WDS4	0.974	0.976	2.496E-75	446	0.817	0.818	X1WDS4.pdb.gz	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
7	AFDB:P36872	0.959	0.861	1.896E-74	499	0.783	0.701	P36872.pdb.gz	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
8	AFDB:G5EDR3	0.943	0.853	1.543E-67	495	0.653	0.590	G5EDR3.pdb.gz	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
9	AFDB:C8VMY3	0.889	0.843	2.034E-61	472	0.584	0.553	C8VMY3.pdb.gz	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
10	AFDB:Q54Q99	0.878	0.814	8.044E-59	483	0.539	0.499	Q54Q99.pdb.gz	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1
11	AFDB:Q39247	0.868	0.776	4.474E-58	501	0.550	0.491	Q39247.pdb.gz	2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AB2 PE=1 SV=1
12	PDB:2h9lA	0.562	0.767	1.142E-14	321	0.159	0.221	2h9lA.pdb.gz
13	PDB:6bk8D	0.552	0.679	5.725E-14	359	0.125	0.156	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
14	PDB:5nnzA	0.497	0.641	6.353E-14	335	0.143	0.191	5nnzA.pdb.gz
15	PDB:7mqaLO	0.434	0.251	1.893E-13	819	0.134	0.073	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6bk8M	0.532	0.715	2.725E-13	326	0.105	0.144	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:7r5jS0	0.550	0.743	2.725E-13	322	0.134	0.186	7r5jS0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:5mzhB	0.504	0.539	4.583E-13	415	0.143	0.154	5mzhB.pdb.gz
19	PDB:5yzgs	0.556	0.657	5.944E-13	374	0.128	0.152	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:7fikF	0.538	0.717	6.595E-13	326	0.128	0.175	7fikF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BG80	0.0	876	448	0.928	0.926	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
2	G5EDR3	0.0	601	495	0.658	0.594	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
3	P36872	0.0	748	499	0.779	0.697	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
4	P36876	0.0	936	447	0.998	0.998	2ABA_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2a PE=2 SV=1
5	P36877	0.0	808	443	0.841	0.849	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
6	P56932	0.0	843	453	0.881	0.870	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
7	P63151	0.0	936	447	1.000	1.000	2ABA_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1
8	Q00005	0.0	810	443	0.841	0.849	2ABB_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Homo sapiens OX=9606 GN=PPP2R2B PE=1 SV=1
9	Q66LE6	0.0	839	453	0.875	0.863	2ABD_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Homo sapiens OX=9606 GN=PPP2R2D PE=1 SV=1
10	Q6IRD3	0.0	884	444	0.940	0.946	Q6IRD3_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Xenopus laevis OX=8355 GN=ppp2r2a.S PE=1 SV=1
11	Q6NY64	0.0	860	447	0.904	0.904	2ABD_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Danio rerio OX=7955 GN=ppp2r2d PE=2 SV=1
12	Q6P1F6	0.0	936	447	1.000	1.000	2ABA_MOUSE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r2a PE=1 SV=1
13	Q6PGU9	0.0	870	448	0.924	0.922	Q6PGU9_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2d PE=1 SV=1
14	Q7ZX64	0.0	849	447	0.890	0.890	2ABD_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Xenopus laevis OX=8355 GN=ppp2r2d PE=1 SV=1
15	Q9Y2T4	0.0	776	447	0.801	0.801	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
16	X1WDS4	0.0	778	446	0.819	0.821	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
17	C8VMY3	1.34e-174	499	472	0.584	0.553	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
18	Q12702	5.86e-172	492	463	0.570	0.551	2ABA_SCHPO Protein phosphatase PP2A regulatory subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
19	Q39247	4.72e-161	466	501	0.550	0.491	2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AB2 PE=1 SV=1
20	Q54Q99	1.50e-159	461	483	0.535	0.495	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.037	25.6	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00400 WD40	1.9e-06	39.7	WD domain, G-beta repeat
3	PF03162 Y_phosphatase2	1.6e+02	13.3	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10116.ENSRNOP00000015318

Rank	PPI partner	STRING score	Description
1	10116.ENSRNOP00000015019	0.999	Protein phosphatase 2, regulatory subunit A, alpha
2	10116.ENSRNOP00000007621	0.998	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
3	10116.ENSRNOP00000059428	0.997	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
4	10116.ENSRNOP00000020663	0.993	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
5	10116.ENSRNOP00000019640	0.990	Methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha- leucine ester residues
6	10116.ENSRNOP00000023649	0.981	Demethylates proteins that have been reversibly carboxymethylated. Demethylates PPP2CB (in vitro) and PPP2CA. Binding to PPP2CA displaces the manganese ion and inactivates the enzyme (By similarity)
7	10116.ENSRNOP00000023139	0.970	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
8	10116.ENSRNOP00000065433	0.957	Protein phosphatase 2, regulatory subunit B'', beta
9	10116.ENSRNOP00000025282	0.934	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
10	10116.ENSRNOP00000026909	0.932	Protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, DNA repair, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3. The PPP4C-PPP4R2- PPP4R3A PP4 complex specifically dephosphorylates H2AX phosphorylated on Ser-140 (gamma-H2AX) generated during DNA replic [...]
11	10116.ENSRNOP00000063017	0.929	RB transcriptional corepressor-like 1
12	10116.ENSRNOP00000008003	0.921	Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response (By similarity)
13	10116.ENSRNOP00000027734	0.913	Barrier-to-autointegration factor
14	10116.ENSRNOP00000017361	0.911	Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation, associates preferentially with E2F5. Binds to cyclins A [...]
15	10116.ENSRNOP00000024914	0.908	Serine/threonine-protein phosphatase 2A activator
16	10116.ENSRNOP00000028542	0.908	Protein phosphatase 2, regulatory subunit B', beta
17	10116.ENSRNOP00000065720	0.908	annotation not available
18	10116.ENSRNOP00000061977	0.896	Regulatory subunit of serine/threonine-protein phosphatase 4. May play a role in regulation of cell division in renal glomeruli. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3 (By similarity)
19	10116.ENSRNOP00000049674	0.874	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
20	10116.ENSRNOP00000047912	0.867	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019888	0.946	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032501	0.967	multicellular organismal process
GO:0048856	0.958	anatomical structure development
GO:0050896	0.947	response to stimulus
GO:0007275	0.915	multicellular organism development
GO:0065007	0.907	biological regulation
GO:0071704	0.896	organic substance metabolic process
GO:0044237	0.883	cellular metabolic process
GO:0050794	0.880	regulation of cellular process
GO:0009653	0.841	anatomical structure morphogenesis
GO:0042221	0.839	response to chemical
GO:0030154	0.801	cell differentiation
GO:0016311	0.775	dephosphorylation
GO:0044238	0.761	primary metabolic process
GO:0048731	0.749	system development
GO:0006807	0.745	nitrogen compound metabolic process
GO:0016043	0.737	cellular component organization
GO:0003158	0.701	endothelium development
GO:0010033	0.677	response to organic substance
GO:0003159	0.666	morphogenesis of an endothelium
GO:0043170	0.651	macromolecule metabolic process
GO:0061154	0.645	endothelial tube morphogenesis
GO:1901564	0.609	organonitrogen compound metabolic process
GO:0019538	0.591	protein metabolic process
GO:0010243	0.562	response to organonitrogen compound
GO:0006996	0.531	organelle organization
GO:0048514	0.528	blood vessel morphogenesis
GO:0043279	0.519	response to alkaloid
GO:0036211	0.461	protein modification process
GO:0048518	0.451	positive regulation of biological process
GO:0014070	0.321	response to organic cyclic compound
GO:0006470	0.315	protein dephosphorylation
GO:0019222	0.310	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.996	nucleus
GO:0005829	0.989	cytosol
GO:0032991	0.979	protein-containing complex
GO:0030054	0.927	cell junction
GO:1902494	0.926	catalytic complex
GO:0045202	0.923	synapse
GO:0031974	0.913	membrane-enclosed lumen
GO:0043233	0.898	organelle lumen
GO:0070013	0.894	intracellular organelle lumen
GO:0031981	0.869	nuclear lumen
GO:1903293	0.794	phosphatase complex
GO:0005654	0.790	nucleoplasm
GO:0000159	0.781	protein phosphatase type 2A complex
GO:0016020	0.340	membrane
GO:0043232	0.301	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]