StarFunc result for job id P63165

User Input

>input (101 residues)
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O57686	0.746	0.739	3.659E-19	102	0.921	0.912	O57686.pdb.gz	SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis OX=8355 GN=sumo1-a PE=1 SV=1
2	AFDB:G2XKQ0	0.809	0.809	5.110E-19	101	0.881	0.881	G2XKQ0.pdb.gz	SUMO5_HUMAN Small ubiquitin-related modifier 5 OS=Homo sapiens OX=9606 GN=SUMO1P1 PE=1 SV=2
3	AFDB:Q7SZR5	0.761	0.768	1.105E-17	100	0.832	0.840	Q7SZR5.pdb.gz	SUMO1_DANRE Small ubiquitin-related modifier 1 OS=Danio rerio OX=7955 GN=sumo1 PE=3 SV=1
4	AFDB:B8ZZN6	0.770	0.548	1.955E-16	146	1.000	0.692	B8ZZN6.pdb.gz	B8ZZN6_HUMAN Small ubiquitin like modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
5	PDB:1a5rA	0.583	0.574	1.741E-14	103	1.000	0.981	1a5rA.pdb.gz
6	AFDB:P55853	0.745	0.824	6.999E-14	91	0.525	0.582	P55853.pdb.gz	SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans OX=6239 GN=smo-1 PE=1 SV=1
7	AFDB:O13351	0.797	0.696	1.784E-13	117	0.495	0.427	O13351.pdb.gz	PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmt3 PE=1 SV=2
8	AFDB:Q9Z172	0.749	0.690	3.977E-13	110	0.436	0.400	Q9Z172.pdb.gz	SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus OX=10090 GN=Sumo3 PE=1 SV=1
9	AFDB:Q57Z72	0.780	0.696	5.555E-13	114	0.406	0.360	Q57Z72.pdb.gz	Q57Z72_TRYB2 Small ubiquitin protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.260 PE=1 SV=1
10	AFDB:Q8N0B4	0.740	0.762	5.555E-13	98	0.436	0.449	Q8N0B4.pdb.gz	Q8N0B4_DICDI Small ubiquitin-like protein OS=Dictyostelium discoideum OX=44689 GN=SUMO PE=2 SV=1
11	AFDB:Q8I444	0.726	0.733	1.084E-12	100	0.396	0.400	Q8I444.pdb.gz	Q8I444_PLAF7 Small ubiquitin-related modifier OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0505800 PE=4 SV=1
12	PDB:5xqmA	0.659	0.732	1.588E-11	90	0.545	0.611	5xqmA.pdb.gz
13	PDB:1wz0A	0.692	0.672	2.151E-10	104	0.426	0.413	1wz0A.pdb.gz
14	PDB:3pgeA	0.703	0.422	8.187E-10	172	0.416	0.244	3pgeA.pdb.gz
15	PDB:6rpqA	0.709	0.297	9.358E-10	249	0.396	0.161	6rpqA.pdb.gz
16	PDB:2k1fA	0.612	0.688	1.397E-9	88	0.436	0.500	2k1fA.pdb.gz
17	PDB:6xogC	0.565	0.898	2.550E-9	62	0.604	0.984	6xogC.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
18	PDB:3tixA	0.702	0.470	4.974E-9	153	0.376	0.248	3tixA.pdb.gz
19	PDB:3dbhI	0.693	0.798	2.643E-8	86	0.168	0.198	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:7rbsB	0.712	0.469	9.409E-8	157	0.158	0.102	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7WLH8	2.34e-71	209	101	1.000	1.000	SUMO1_PIG Small ubiquitin-related modifier 1 OS=Sus scrofa OX=9823 GN=SUMO1 PE=3 SV=1
2	P63165	2.34e-71	209	101	1.000	1.000	SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
3	P63166	2.34e-71	209	101	1.000	1.000	SUMO1_MOUSE Small ubiquitin-related modifier 1 OS=Mus musculus OX=10090 GN=Sumo1 PE=1 SV=1
4	Q5I0H3	2.34e-71	209	101	1.000	1.000	SUMO1_RAT Small ubiquitin-related modifier 1 OS=Rattus norvegicus OX=10116 GN=Sumo1 PE=1 SV=1
5	B8ZZN6	1.04e-63	191	146	1.000	0.692	B8ZZN6_HUMAN Small ubiquitin like modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
6	O57686	1.04e-62	187	102	0.921	0.912	SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis OX=8355 GN=sumo1-a PE=1 SV=1
7	G2XKQ0	6.15e-60	180	101	0.881	0.881	SUMO5_HUMAN Small ubiquitin-related modifier 5 OS=Homo sapiens OX=9606 GN=SUMO1P1 PE=1 SV=2
8	Q7SZR5	2.51e-55	168	100	0.832	0.840	SUMO1_DANRE Small ubiquitin-related modifier 1 OS=Danio rerio OX=7955 GN=sumo1 PE=3 SV=1
9	B9A032	3.15e-45	142	77	0.762	1.000	B9A032_HUMAN Small ubiquitin like modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
10	P55853	7.06e-35	116	91	0.515	0.571	SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans OX=6239 GN=smo-1 PE=1 SV=1
11	B8ZZJ0	6.37e-34	113	58	0.545	0.948	B8ZZJ0_HUMAN Small ubiquitin like modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
12	O13351	1.02e-26	96.7	117	0.495	0.427	PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmt3 PE=1 SV=2
13	Q9Z172	2.34e-26	95.9	110	0.436	0.400	SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus OX=10090 GN=Sumo3 PE=1 SV=1
14	P55854	5.09e-26	94.7	103	0.436	0.427	SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens OX=9606 GN=SUMO3 PE=1 SV=2
15	O97102	6.67e-26	94.0	90	0.455	0.511	O97102_DROME Small ubiquitin-related modifier OS=Drosophila melanogaster OX=7227 GN=Sumo PE=1 SV=1
16	Q6DHL4	1.03e-25	93.6	96	0.416	0.438	SUMO2_DANRE Small ubiquitin-related modifier 2 OS=Danio rerio OX=7955 GN=sumo2 PE=3 SV=1
17	Q6NV25	1.85e-25	92.8	94	0.426	0.457	SMO3L_DANRE Small ubiquitin-related modifier 3-like OS=Danio rerio OX=7955 GN=sumo3l PE=3 SV=1
18	Q57Z72	1.19e-24	91.7	114	0.396	0.351	Q57Z72_TRYB2 Small ubiquitin protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.260 PE=1 SV=1
19	P61956	1.23e-24	90.9	95	0.406	0.432	SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 PE=1 SV=3
20	P61957	1.23e-24	90.9	95	0.406	0.432	SUMO2_MOUSE Small ubiquitin-related modifier 2 OS=Mus musculus OX=10090 GN=Sumo2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11976 Rad60-SLD	2.4e-18	77.0	Ubiquitin-2 like Rad60 SUMO-like
2	PF00240 ubiquitin	2.5e-15	67.3	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10181.XP_004851262.1

Rank	PPI partner	STRING score	Description
1	10181.XP_004844571.1	0.999	E3 SUMO-protein ligase RanBP2
2	10181.XP_004873904.1	0.999	SUMO-conjugating enzyme UBC9 isoform X1
3	10181.XP_004845583.1	0.997	Ran GTPase-activating protein 1
4	10181.XP_004858950.1	0.997	SUMO-activating enzyme subunit 2 isoform X1
5	10181.XP_004846862.1	0.996	Death domain-associated protein 6 isoform X1
6	10181.XP_004844891.1	0.994	G/T mismatch-specific thymine DNA glycosylase
7	10181.XP_004855153.1	0.994	E3 SUMO-protein ligase PIAS2
8	10181.XP_004857505.1	0.994	Acts as a tumor suppressor in many tumor types
9	10181.XP_004863155.1	0.994	Sentrin-specific protease 1 isoform X1
10	10181.XP_004867130.1	0.994	SUMO-activating enzyme subunit 1 isoform a
11	10181.XP_004855543.1	0.992	Putative transcription factor PML
12	10181.XP_004834896.1	0.986	Sentrin-specific protease 2 isoform X1
13	10181.XP_004864823.1	0.982	CREB-binding protein
14	10181.XP_004855644.1	0.972	E3 SUMO-protein ligase PIAS1
15	10181.XP_004865831.1	0.969	E3 SUMO-protein ligase PIAS4
16	10181.XP_004868089.1	0.945	Nuclear autoantigen Sp-100
17	10181.XP_004853964.1	0.930	E3 SUMO-protein ligase PIAS3 isoform X1
18	10181.XP_004834769.1	0.910	Sentrin-specific protease 5
19	10181.XP_004871834.1	0.905	Androgen receptor-like
20	10181.XP_004901660.1	0.902	Upstream in-frame stop codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0009987	0.991	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.983	macromolecule metabolic process
GO:0050896	0.958	response to stimulus
GO:0048518	0.946	positive regulation of biological process
GO:0019222	0.945	regulation of metabolic process
GO:0065009	0.943	regulation of molecular function
GO:0034762	0.935	regulation of transmembrane transport
GO:0016925	0.928	protein sumoylation
GO:0048522	0.893	positive regulation of cellular process
GO:0032409	0.865	regulation of transporter activity
GO:0034765	0.858	regulation of monoatomic ion transmembrane transport
GO:0042221	0.855	response to chemical
GO:0033554	0.850	cellular response to stress
GO:0070887	0.840	cellular response to chemical stimulus
GO:1904062	0.835	regulation of monoatomic cation transmembrane transport
GO:0009628	0.822	response to abiotic stimulus
GO:0060255	0.780	regulation of macromolecule metabolic process
GO:0080090	0.739	regulation of primary metabolic process
GO:0051171	0.738	regulation of nitrogen compound metabolic process
GO:0031323	0.722	regulation of cellular metabolic process
GO:0070482	0.700	response to oxygen levels
GO:0065008	0.668	regulation of biological quality
GO:0044093	0.652	positive regulation of molecular function
GO:0071453	0.650	cellular response to oxygen levels
GO:0032412	0.632	regulation of monoatomic ion transmembrane transporter activity
GO:0051179	0.610	localization
GO:0033036	0.602	macromolecule localization
GO:0010959	0.596	regulation of metal ion transport
GO:0051641	0.587	cellular localization
GO:0044237	0.559	cellular metabolic process
GO:0070727	0.546	cellular macromolecule localization
GO:0071840	0.539	cellular component organization or biogenesis
GO:0001666	0.516	response to hypoxia
GO:0009893	0.506	positive regulation of metabolic process
GO:0016043	0.497	cellular component organization
GO:0036294	0.496	cellular response to decreased oxygen levels
GO:0048519	0.486	negative regulation of biological process
GO:0010468	0.479	regulation of gene expression
GO:0019219	0.479	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.471	negative regulation of cellular process
GO:0010604	0.462	positive regulation of macromolecule metabolic process
GO:0031326	0.458	regulation of cellular biosynthetic process
GO:0010556	0.457	regulation of macromolecule biosynthetic process
GO:0051252	0.457	regulation of RNA metabolic process
GO:0071456	0.456	cellular response to hypoxia
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0006355	0.449	regulation of DNA-templated transcription
GO:0032501	0.447	multicellular organismal process
GO:0032502	0.445	developmental process
GO:0031325	0.398	positive regulation of cellular metabolic process
GO:0048856	0.384	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0016020	0.955	membrane
GO:0016604	0.919	nuclear body
GO:0005694	0.885	chromosome
GO:0016605	0.720	PML body
GO:0012505	0.684	endomembrane system
GO:0005737	0.675	cytoplasm
GO:0005730	0.615	nucleolus
GO:0032991	0.492	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]