StarFunc result for job id P63167

User Input

>input (89 residues)
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1RM30	0.983	0.697	1.792E-16	126	0.933	0.659	Q1RM30.pdb.gz
2	AFDB:Q39580	0.984	0.963	2.469E-16	91	0.888	0.868	Q39580.pdb.gz	DYL1_CHLRE Dynein 8 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
3	AFDB:Q4FKD8	0.973	0.963	1.486E-15	90	0.831	0.822	Q4FKD8.pdb.gz	Q4FKD8_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.0845 PE=3 SV=1
4	PDB:1re6A	0.896	0.852	1.895E-14	94	0.933	0.883	1re6A.pdb.gz
5	AFDB:Q9UR05	0.941	0.985	5.379E-14	85	0.708	0.741	Q9UR05.pdb.gz	DYL1_SCHPO Dynein light chain 1, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dlc2 PE=3 SV=1
6	AFDB:Q387L9	0.971	0.960	7.901E-14	90	0.618	0.611	Q387L9.pdb.gz	Q387L9_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0815 PE=3 SV=1
7	AFDB:O94111	0.946	0.896	1.319E-13	94	0.652	0.617	O94111.pdb.gz	DYL1_EMENI Dynein light chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudG PE=3 SV=1
8	AFDB:Q84VW0	0.951	0.689	2.670E-13	123	0.674	0.488	Q84VW0.pdb.gz	Q84VW0_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=DL4005W PE=1 SV=1
9	PDB:4ds1A	0.941	0.973	2.472E-12	86	0.461	0.477	4ds1A.pdb.gz	Structure of a yeast Dyn2-Nup159 complex and molecular basis for dynein light chain-nuclear pore interaction.
10	AFDB:Q02647	0.942	0.911	3.467E-12	92	0.461	0.446	Q02647.pdb.gz	DYL1_YEAST Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN2 PE=1 SV=1
11	AFDB:Q57Z05	0.915	0.905	6.613E-11	90	0.449	0.444	Q57Z05.pdb.gz	Q57Z05_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.790 PE=3 SV=1
12	AFDB:Q4W5W8	0.923	0.269	5.142E-10	313	0.449	0.128	Q4W5W8.pdb.gz	Q4W5W8_VICFA Dynein light chain OS=Vicia faba OX=3906 GN=vfPIP PE=1 SV=1
13	PDB:1xdxA	0.483	0.410	3.143E-2	114	0.112	0.088	1xdxA.pdb.gz
14	PDB:3fm7B	0.361	0.316	1.900	104	0.079	0.067	3fm7B.pdb.gz	Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
15	PDB:7v6cB	0.291	0.119	2.160	260	0.101	0.035	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
16	PDB:1q3bA	0.233	0.101	2.618	259	0.045	0.015	1q3bA.pdb.gz	Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
17	PDB:7eu1H	0.166	0.106	2.618	142	0.090	0.056	7eu1H.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
18	PDB:3aquA	0.152	0.054	2.791	344	0.090	0.023	3aquA.pdb.gz
19	PDB:1ihoA	0.351	0.142	2.976	282	0.112	0.035	1ihoA.pdb.gz
20	PDB:2a3zB	0.276	0.117	3.173	260	0.157	0.054	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61285	7.97e-64	189	89	1.000	1.000	DYL1_BOVIN Dynein light chain 1, cytoplasmic OS=Bos taurus OX=9913 GN=DYNLL1 PE=1 SV=1
2	P63167	7.97e-64	189	89	1.000	1.000	DYL1_HUMAN Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1
3	P63168	7.97e-64	189	89	1.000	1.000	DYL1_MOUSE Dynein light chain 1, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll1 PE=1 SV=1
4	P63170	7.97e-64	189	89	1.000	1.000	DYL1_RAT Dynein light chain 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll1 PE=1 SV=1
5	Q24117	1.20e-60	181	89	0.944	0.944	DYL1_DROME Dynein light chain 1, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ctp PE=1 SV=1
6	O96860	2.91e-60	180	89	0.944	0.944	DYL2_DROME Dynein light chain 2, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Cdlc2 PE=1 SV=1
7	Q7SZP6	2.98e-60	181	115	0.933	0.722	Q7SZP6_DANRE Dynein light chain (Fragment) OS=Danio rerio OX=7955 GN=dnl2 PE=2 SV=2
8	Q78P75	4.62e-60	179	89	0.933	0.933	DYL2_RAT Dynein light chain 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll2 PE=1 SV=1
9	Q96FJ2	4.62e-60	179	89	0.933	0.933	DYL2_HUMAN Dynein light chain 2, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL2 PE=1 SV=1
10	Q9D0M5	4.62e-60	179	89	0.933	0.933	DYL2_MOUSE Dynein light chain 2, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll2 PE=1 SV=1
11	Q5BL99	4.77e-60	179	89	0.933	0.933	Q5BL99_DANRE Dynein light chain OS=Danio rerio OX=7955 GN=dynll2b PE=1 SV=1
12	Q22799	1.34e-59	178	89	0.921	0.921	DYL1_CAEEL Dynein light chain 1, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=dlc-1 PE=1 SV=1
13	Q39580	2.13e-56	170	91	0.888	0.868	DYL1_CHLRE Dynein 8 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
14	Q4FKD8	5.88e-52	159	90	0.820	0.811	Q4FKD8_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.0845 PE=3 SV=1
15	Q9UR05	5.26e-46	144	85	0.708	0.741	DYL1_SCHPO Dynein light chain 1, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dlc2 PE=3 SV=1
16	Q84VW0	1.12e-42	137	123	0.674	0.488	Q84VW0_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=DL4005W PE=1 SV=1
17	Q387L9	1.15e-40	130	90	0.618	0.611	Q387L9_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0815 PE=3 SV=1
18	O94111	1.56e-40	130	94	0.652	0.617	DYL1_EMENI Dynein light chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudG PE=3 SV=1
19	Q02647	6.11e-30	103	92	0.461	0.446	DYL1_YEAST Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN2 PE=1 SV=1
20	Q57Z05	8.03e-26	93.2	90	0.438	0.433	Q57Z05_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.790 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01221 Dynein_light	7.6e-39	143.3	Dynein light chain type 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 59538.XP_005962028.1

Rank	PPI partner	STRING score	Description
1	59538.XP_005978616.1	0.970	Dynein cytoplasmic 1 heavy chain 1
2	59538.XP_005976896.1	0.969	Dynein light chain roadblock-type 1
3	59538.XP_005976990.1	0.967	Cytoplasmic dynein 1 intermediate chain 2 isoform X1
4	59538.XP_005954590.1	0.962	Dynein cytoplasmic 1 intermediate chain 1
5	59538.XP_005955970.1	0.956	Dynein light chain Tctex-type 1
6	59538.XP_005974631.1	0.956	Dynein cytoplasmic 2 heavy chain 1
7	59538.XP_005959406.1	0.951	Bcl-2-like protein 11-like
8	59538.XP_005981872.1	0.951	Dynein cytoplasmic 2 light intermediate chain 1
9	59538.XP_005962573.1	0.947	WD repeat-containing protein 60
10	59538.XP_005982730.1	0.947	WD repeat-containing protein 34
11	59538.XP_005959962.1	0.939	Dynein light chain 2, cytoplasmic-like
12	59538.XP_005962494.1	0.938	Dynein light chain 2, cytoplasmic
13	59538.XP_005984230.1	0.934	Dynein light chain roadblock-type 2
14	59538.XP_005965254.1	0.933	Dynactin subunit 1 isoform X1
15	59538.XP_005971829.1	0.923	Cytoplasmic dynein 1 light intermediate chain 1
16	59538.XP_005959267.1	0.910	Cytoplasmic dynein 1 light intermediate chain 2
17	59538.XP_005954332.1	0.895	Dynein light chain Tctex-type 3
18	59538.XP_005953943.1	0.894	Dynactin subunit 4 isoform X1
19	59538.XP_005975800.1	0.887	Platelet-activating factor acetylhydrolase IB subunit alpha
20	59538.XP_005957873.1	0.875	nudE neurodevelopment protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.991	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0048856	0.970	anatomical structure development
GO:0032501	0.918	multicellular organismal process
GO:0007275	0.862	multicellular organism development
GO:0048731	0.807	system development
GO:0071840	0.746	cellular component organization or biogenesis
GO:0048857	0.720	neural nucleus development
GO:0016043	0.717	cellular component organization
GO:0007017	0.712	microtubule-based process
GO:0006996	0.699	organelle organization
GO:0019222	0.688	regulation of metabolic process
GO:0060322	0.655	head development
GO:0007399	0.638	nervous system development
GO:0051641	0.631	cellular localization
GO:0051234	0.628	establishment of localization
GO:0048513	0.592	animal organ development
GO:0051649	0.591	establishment of localization in cell
GO:0030901	0.556	midbrain development
GO:0048518	0.520	positive regulation of biological process
GO:0048522	0.496	positive regulation of cellular process
GO:0048519	0.491	negative regulation of biological process
GO:0031323	0.480	regulation of cellular metabolic process
GO:0048523	0.467	negative regulation of cellular process
GO:0008152	0.393	metabolic process
GO:0046907	0.352	intracellular transport
GO:0051640	0.345	organelle localization
GO:0044237	0.340	cellular metabolic process
GO:0051656	0.340	establishment of organelle localization
GO:0022607	0.301	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	1.000	microtubule cytoskeleton
GO:1902494	0.995	catalytic complex
GO:0005737	0.995	cytoplasm
GO:0030286	0.981	dynein complex
GO:0043227	0.949	membrane-bounded organelle
GO:0005868	0.765	cytoplasmic dynein complex
GO:0016020	0.700	membrane
GO:0042995	0.661	cell projection
GO:0043231	0.625	intracellular membrane-bounded organelle
GO:0005829	0.577	cytosol
GO:0005634	0.453	nucleus
GO:0120025	0.429	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]