StarFunc result for job id P63261

User Input

>input (375 residues)
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B6VNT8	0.998	0.993	3.412E-76	377	0.941	0.936	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
2	AFDB:P07829	0.996	0.993	6.389E-76	376	0.931	0.928	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
3	AFDB:P10989	0.997	0.997	5.159E-74	375	0.915	0.915	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
4	AFDB:Q562R1	0.997	0.994	5.159E-74	376	0.912	0.910	Q562R1.pdb.gz	ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2
5	AFDB:P0CJ46	0.994	0.988	1.023E-73	377	0.891	0.886	P0CJ46.pdb.gz	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
6	AFDB:A5A3E0	0.995	0.348	8.933E-73	1075	0.909	0.317	A5A3E0.pdb.gz	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
7	AFDB:A0A1D8PFR4	0.994	0.991	3.132E-72	376	0.861	0.859	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
8	AFDB:P86287	0.993	0.990	1.637E-71	376	0.824	0.822	P86287.pdb.gz	ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=ACT1 PE=1 SV=1
9	AFDB:Q8RYC2	0.994	0.987	1.697E-70	378	0.792	0.786	Q8RYC2.pdb.gz	ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana OX=3702 GN=ACT5 PE=5 SV=1
10	AFDB:P07828	0.990	0.977	2.013E-70	380	0.845	0.834	P07828.pdb.gz	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
11	PDB:1c0gA	0.962	0.980	6.794E-70	368	0.920	0.938	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
12	PDB:1yagA	0.976	0.984	1.347E-69	372	0.888	0.895	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
13	PDB:6tu4A	0.955	0.962	7.244E-65	372	0.819	0.825	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:4cbxA	0.941	0.984	5.294E-61	358	0.731	0.765	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
15	PDB:4pl7A	0.915	0.898	5.685E-59	382	0.784	0.770	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
16	PDB:4a7fA	0.925	0.925	2.452E-57	375	0.936	0.936	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
17	PDB:6ltjK	0.816	0.963	1.457E-46	317	0.829	0.981	6ltjK.pdb.gz	Structure of nucleosome-bound human BAF complex.
18	PDB:7nvmK	0.717	0.839	1.543E-46	317	0.832	0.984	7nvmK.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
19	PDB:5kg8B	0.792	0.943	5.809E-44	313	0.781	0.936	5kg8B.pdb.gz
20	PDB:6w18B	0.874	0.892	7.782E-39	367	0.472	0.482	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PFR4	704	376	0.861	0.859	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
2	A5A3E0	724	1075	0.909	0.317	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
3	B6VNT8	747	377	0.941	0.936	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
4	F1P476	748	377	0.941	0.936	F1P476_CHICK Actin, alpha 2, smooth muscle, aorta OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
5	F1RCB6	739	377	0.928	0.923	F1RCB6_DANRE Actin alpha cardiac muscle 1a OS=Danio rerio OX=7955 GN=zgc:86725 PE=1 SV=1
6	G1NS52	780	376	0.989	0.987	G1NS52_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 GN=LOC100542800 PE=3 SV=1
7	G3CKA6	754	376	0.944	0.941	G3CKA6_SPOFR Actin OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
8	O45815	720	375	0.936	0.936	O45815_CAEEL Actin OS=Caenorhabditis elegans OX=6239 GN=act-5 PE=1 SV=1
9	P02572	773	376	0.973	0.971	ACT2_DROME Actin-42A OS=Drosophila melanogaster OX=7227 GN=Act42A PE=1 SV=3
10	P07828	678	380	0.840	0.829	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
11	P07829	739	376	0.925	0.923	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
12	P07830	749	376	0.947	0.944	ACT1_DICDI Major actin OS=Dictyostelium discoideum OX=44689 GN=act1 PE=1 SV=2
13	P08023	748	377	0.939	0.934	ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
14	P0CG38	726	1075	0.907	0.316	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
15	P0CG39	720	1038	0.901	0.326	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
16	P0CJ46	716	377	0.891	0.886	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
17	P0CJ47	716	377	0.891	0.886	ACT3_ARATH Actin-3 OS=Arabidopsis thaliana OX=3702 GN=ACT3 PE=1 SV=1
18	P0DM41	768	376	0.965	0.963	ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans OX=6239 GN=act-1 PE=1 SV=1
19	P0DM42	768	376	0.965	0.963	ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans OX=6239 GN=act-3 PE=3 SV=1
20	P10981	760	376	0.952	0.949	ACT5_DROME Actin-87E OS=Drosophila melanogaster OX=7227 GN=Act87E PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	1.1e-147	503.3	Actin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000023255

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004152	0.976	Cofilin 2 (muscle)
2	61853.ENSNLEP00000007082	0.968	Cofilin 1 (non-muscle)
3	61853.ENSNLEP00000012408	0.964	Uncharacterized protein
4	61853.ENSNLEP00000007056	0.963	Actin-like 6A
5	61853.ENSNLEP00000013240	0.961	Caspase 3, apoptosis-related cysteine peptidase
6	61853.ENSNLEP00000014778	0.955	Wiskott-Aldrich syndrome-like
7	61853.ENSNLEP00000021166	0.955	Profilin
8	61853.ENSNLEP00000003430	0.951	Actin-related protein 2/3 complex subunit 3
9	61853.ENSNLEP00000012127	0.948	ARP2 actin-related protein 2 homolog (yeast)
10	61853.ENSNLEP00000009578	0.945	Wiskott-Aldrich syndrome
11	61853.ENSNLEP00000002500	0.944	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
12	61853.ENSNLEP00000010020	0.943	Cell division cycle 42
13	61853.ENSNLEP00000013329	0.942	Ezrin
14	61853.ENSNLEP00000005090	0.941	Actin-related protein 2/3 complex subunit 4
15	61853.ENSNLEP00000001438	0.940	Actinin, alpha 1
16	61853.ENSNLEP00000010284	0.939	Arp2/3 complex 34 kDa subunit
17	61853.ENSNLEP00000012211	0.939	Myosin, heavy chain 10, non-muscle
18	61853.ENSNLEP00000013359	0.939	Actin related protein 2/3 complex, subunit 1A, 41kDa
19	61853.ENSNLEP00000014469	0.939	Actin-like 6B
20	61853.ENSNLEP00000020429	0.936	Eukaryotic translation initiation factor 3 subunit K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0032502	0.979	developmental process
GO:0065007	0.921	biological regulation
GO:0050789	0.905	regulation of biological process
GO:0050794	0.894	regulation of cellular process
GO:0071840	0.886	cellular component organization or biogenesis
GO:0016043	0.875	cellular component organization
GO:0032501	0.726	multicellular organismal process
GO:0048856	0.718	anatomical structure development
GO:0050896	0.680	response to stimulus
GO:0048518	0.604	positive regulation of biological process
GO:0019222	0.475	regulation of metabolic process
GO:0060255	0.441	regulation of macromolecule metabolic process
GO:0007275	0.430	multicellular organism development
GO:0051716	0.400	cellular response to stimulus
GO:0048522	0.338	positive regulation of cellular process
GO:0030029	0.337	actin filament-based process
GO:0008152	0.319	metabolic process
GO:0048519	0.311	negative regulation of biological process
GO:0080090	0.311	regulation of primary metabolic process
GO:0051171	0.309	regulation of nitrogen compound metabolic process
GO:0031323	0.308	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0005886	0.988	plasma membrane
GO:0030054	0.966	cell junction
GO:0005856	0.966	cytoskeleton
GO:0043227	0.961	membrane-bounded organelle
GO:0015629	0.919	actin cytoskeleton
GO:0005634	0.899	nucleus
GO:0005576	0.885	extracellular region
GO:0031982	0.873	vesicle
GO:0032991	0.863	protein-containing complex
GO:0099080	0.851	supramolecular complex
GO:0005615	0.514	extracellular space
GO:0043230	0.491	extracellular organelle
GO:0070062	0.478	extracellular exosome
GO:0099081	0.453	supramolecular polymer
GO:0099512	0.417	supramolecular fiber
GO:0070013	0.376	intracellular organelle lumen
GO:0042995	0.372	cell projection
GO:0031981	0.369	nuclear lumen
GO:0070161	0.329	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]