StarFunc result for job id P63272

User Input

>input (117 residues)
MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGI
IAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P63271	1.000	1.000	5.195E-27	117	1.000	1.000	P63271.pdb.gz	SPT4A_MOUSE Transcription elongation factor SPT4-A OS=Mus musculus OX=10090 GN=Supt4h1a PE=2 SV=1
2	PDB:3h7hA	0.996	0.988	4.314E-25	118	0.991	0.983	3h7hA.pdb.gz	Crystal structure of the human transcription elongation factor DSIF hSpt4 subunit in complex with the hSpt5 dimerization interface
3	AFDB:Q9TVQ5	0.963	0.971	4.585E-21	116	0.598	0.603	Q9TVQ5.pdb.gz	SPT4H_DROME Transcription elongation factor SPT4 OS=Drosophila melanogaster OX=7227 GN=spt4 PE=1 SV=1
4	AFDB:J3QSB9	0.799	0.866	1.296E-17	108	0.803	0.870	J3QSB9.pdb.gz	J3QSB9_HUMAN Transcription elongation factor SPT4 OS=Homo sapiens OX=9606 GN=SUPT4H1 PE=1 SV=1
5	AFDB:Q94C60	0.864	0.871	2.154E-12	116	0.350	0.353	Q94C60.pdb.gz	SPT42_ARATH Transcription elongation factor SPT4 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At5g63670 PE=1 SV=1
6	AFDB:Q9P7K8	0.773	0.858	3.115E-11	105	0.368	0.410	Q9P7K8.pdb.gz	SPT4_SCHPO Transcription elongation factor spt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt4 PE=1 SV=1
7	PDB:2exuA	0.722	0.453	7.023E-11	192	0.359	0.219	2exuA.pdb.gz	Crystal Structure of Saccharomyces cerevisiae transcription elongation factors Spt4-Spt5NGN domain
8	AFDB:P32914	0.744	0.847	1.447E-10	102	0.359	0.412	P32914.pdb.gz	SPT4_YEAST Transcription elongation factor SPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT4 PE=1 SV=1
9	PDB:4zn3B	0.424	0.698	1.635E-3	67	0.154	0.269	4zn3B.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
10	AFDB:Q57839	0.368	0.664	9.171E-3	59	0.154	0.305	Q57839.pdb.gz	SPT4_METJA Transcription elongation factor Spt4 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=spt4 PE=1 SV=1
11	AFDB:Q8U440	0.390	0.688	5.950E-2	61	0.137	0.262	Q8U440.pdb.gz	SPT4_PYRFU Transcription elongation factor Spt4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=spt4 PE=1 SV=1
12	PDB:1ryqA	0.367	0.609	4.772E-1	64	0.145	0.266	1ryqA.pdb.gz	Parameter-space screening: a powerful tool for high-throughput crystal structure determination.
13	AFDB:O53874	0.168	0.044	1.793	756	0.094	0.015	O53874.pdb.gz	O53874_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0862c PE=1 SV=1
14	AFDB:Q9JKL4	0.189	0.122	4.568	185	0.068	0.043	Q9JKL4.pdb.gz	NDUF3_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Mus musculus OX=10090 GN=Ndufaf3 PE=1 SV=1
15	PDB:5z9rB	0.135	0.077	4.622	218	0.043	0.023	5z9rB.pdb.gz
16	PDB:6zxgj	0.167	0.169	4.622	116	0.094	0.095	6zxgj.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
17	PDB:2zb3A	0.156	0.057	4.941	345	0.060	0.020	2zb3A.pdb.gz	Structural basis for catalytic and inhibitory mechanisms of human prostaglandin reductase PTGR2.
18	PDB:2a0fA	0.141	0.054	5.282	310	0.051	0.019	2a0fA.pdb.gz	Structure of the E.coli Aspartate Transcarbamoylase Trapped in the Middle of the Catalytic Cycle.
19	PDB:7t3cB	0.160	0.072	5.647	362	0.068	0.022	7t3cB.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
20	PDB:2yv9A	0.152	0.065	6.037	285	0.060	0.025	2yv9A.pdb.gz	Comparison of vertebrate and invertebrate CLIC proteins: The crystal structures of Caenorhabditis elegans EXC-4 and Drosophila melanogaster DmCLIC

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P63271	1.44e-85	246	117	1.000	1.000	SPT4A_MOUSE Transcription elongation factor SPT4-A OS=Mus musculus OX=10090 GN=Supt4h1a PE=2 SV=1
2	P63272	1.44e-85	246	117	1.000	1.000	SPT4H_HUMAN Transcription elongation factor SPT4 OS=Homo sapiens OX=9606 GN=SUPT4H1 PE=1 SV=1
3	J3QSB9	2.09e-67	200	108	0.803	0.870	J3QSB9_HUMAN Transcription elongation factor SPT4 OS=Homo sapiens OX=9606 GN=SUPT4H1 PE=1 SV=1
4	Q9TVQ5	9.11e-54	166	116	0.598	0.603	SPT4H_DROME Transcription elongation factor SPT4 OS=Drosophila melanogaster OX=7227 GN=spt4 PE=1 SV=1
5	D3DTZ5	1.14e-51	159	76	0.650	1.000	D3DTZ5_HUMAN SPT4 homolog, DSIF elongation factor subunit OS=Homo sapiens OX=9606 GN=SUPT4H1 PE=1 SV=1
6	Q94C60	4.71e-24	90.9	116	0.359	0.362	SPT42_ARATH Transcription elongation factor SPT4 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At5g63670 PE=1 SV=1
7	P32914	1.47e-23	89.0	102	0.368	0.422	SPT4_YEAST Transcription elongation factor SPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT4 PE=1 SV=1
8	Q9P7K8	1.03e-21	84.3	105	0.350	0.390	SPT4_SCHPO Transcription elongation factor spt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt4 PE=1 SV=1
9	Q0JA29	0.15	33.1	1183	0.162	0.016	FLS2_ORYSJ LRR receptor-like serine/threonine-protein kinase FLS2 OS=Oryza sativa subsp. japonica OX=39947 GN=FLS2 PE=1 SV=1
10	P12527	2.2	29.6	673	0.154	0.027	LOX5_RAT Polyunsaturated fatty acid 5-lipoxygenase OS=Rattus norvegicus OX=10116 GN=Alox5 PE=1 SV=3
11	Q6Q6F6	2.3	29.6	436	0.162	0.044	Q6Q6F6_DANRE Estrogen-related receptor alpha OS=Danio rerio OX=7955 GN=erralpha PE=1 SV=1
12	O16220	4.7	28.9	494	0.120	0.028	O16220_CAEEL CYtochrome P450 family OS=Caenorhabditis elegans OX=6239 GN=cyp-35a4 PE=1 SV=1
13	P11474	7.5	28.1	423	0.120	0.033	ERR1_HUMAN Steroid hormone receptor ERR1 OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=3
14	Q569H8	7.5	28.1	423	0.120	0.033	Q569H8_HUMAN ESRRA protein OS=Homo sapiens OX=9606 GN=ESRRA PE=2 SV=1
15	O08580	7.7	28.1	422	0.120	0.033	ERR1_MOUSE Steroid hormone receptor ERR1 OS=Mus musculus OX=10090 GN=Esrra PE=1 SV=4
16	Q5QJV7	7.7	28.1	422	0.120	0.033	ERR1_RAT Steroid hormone receptor ERR1 OS=Rattus norvegicus OX=10116 GN=Esrra PE=1 SV=2
17	O64782	7.9	28.1	805	0.171	0.025	SD129_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-29 OS=Arabidopsis thaliana OX=3702 GN=SD129 PE=1 SV=1
18	A0A6E1WCP9	8.0	28.1	506	0.120	0.028	A0A6E1WCP9_HUMAN Estrogen related receptor alpha OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06093 Spt4	2.4e-29	112.6	Spt4/RpoE2 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009953

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017482	0.999	Transcription elongation factor SPT5
2	61853.ENSNLEP00000003337	0.988	Transcription elongation factor spt6
3	61853.ENSNLEP00000011555	0.985	DNA-directed RNA polymerase subunit
4	61853.ENSNLEP00000003673	0.984	Polymerase (RNA) II (DNA directed) polypeptide C, 33kDa
5	61853.ENSNLEP00000007876	0.984	Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
6	61853.ENSNLEP00000004949	0.983	Polymerase (RNA) II (DNA directed) polypeptide G
7	61853.ENSNLEP00000010889	0.982	DNA-directed RNA polymerase subunit beta
8	61853.ENSNLEP00000019129	0.980	Polymerase (RNA) II (DNA directed) polypeptide D
9	61853.ENSNLEP00000014230	0.975	DNA-directed RNA polymerase subunit
10	61853.ENSNLEP00000017557	0.973	SPT16 homolog, facilitates chromatin remodeling subunit
11	61853.ENSNLEP00000018225	0.967	Polymerase (RNA) II (DNA directed) polypeptide F
12	61853.ENSNLEP00000010593	0.965	Polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
13	61853.ENSNLEP00000001458	0.958	Polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
14	61853.ENSNLEP00000004375	0.950	Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
15	61853.ENSNLEP00000007844	0.940	Negative elongation factor complex member E
16	61853.ENSNLEP00000021930	0.939	Cell division cycle 73
17	61853.ENSNLEP00000000141	0.936	Negative elongation factor complex member A
18	61853.ENSNLEP00000001789	0.933	UBX domain protein 7
19	61853.ENSNLEP00000011180	0.933	Negative elongation factor complex member B
20	61853.ENSNLEP00000021390	0.930	CTR9, Paf1/RNA polymerase II complex component

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0046982	0.993	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.989	primary metabolic process
GO:0034243	0.989	regulation of transcription elongation by RNA polymerase II
GO:0044237	0.987	cellular metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0010605	0.981	negative regulation of macromolecule metabolic process
GO:0045934	0.979	negative regulation of nucleobase-containing compound metabolic process
GO:0006351	0.974	DNA-templated transcription
GO:0045892	0.969	negative regulation of DNA-templated transcription
GO:0006366	0.957	transcription by RNA polymerase II
GO:0006357	0.927	regulation of transcription by RNA polymerase II
GO:0006354	0.646	DNA-templated transcription elongation
GO:0048518	0.635	positive regulation of biological process
GO:0048522	0.567	positive regulation of cellular process
GO:0009893	0.463	positive regulation of metabolic process
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0010604	0.412	positive regulation of macromolecule metabolic process
GO:0045935	0.406	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.370	positive regulation of RNA metabolic process
GO:0006368	0.340	transcription elongation by RNA polymerase II
GO:0045893	0.327	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0140513	0.988	nuclear protein-containing complex
GO:0008023	0.880	transcription elongation factor complex
GO:0043232	0.395	intracellular non-membrane-bounded organelle
GO:0032044	0.382	DSIF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]