StarFunc result for job id P63316

User Input

>input (161 residues)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IQ64	0.909	0.909	2.075E-23	161	0.882	0.882	Q6IQ64.pdb.gz	Q6IQ64_DANRE Slow-specific troponin C OS=Danio rerio OX=7955 GN=stnnc PE=1 SV=1
2	AFDB:A0A060XPN3	0.909	0.909	2.192E-23	161	0.932	0.932	A0A060XPN3.pdb.gz	A0A060XPN3_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00007298001 PE=4 SV=1
3	AFDB:A0A060WZV7	0.640	0.537	5.950E-18	197	0.621	0.508	A0A060WZV7.pdb.gz	A0A060WZV7_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006413001 PE=4 SV=1
4	AFDB:P02585	0.750	0.754	1.287E-17	160	0.634	0.637	P02585.pdb.gz	TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens OX=9606 GN=TNNC2 PE=1 SV=2
5	PDB:2jt0A	0.447	0.447	5.986E-17	161	0.981	0.981	2jt0A.pdb.gz
6	PDB:1a2xA	0.430	0.438	6.563E-14	158	0.640	0.652	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
7	AFDB:P02599	0.485	0.510	1.352E-13	152	0.453	0.480	P02599.pdb.gz	CALM_DICDI Calmodulin OS=Dictyostelium discoideum OX=44689 GN=calA PE=1 SV=3
8	AFDB:F4IVN6	0.538	0.486	2.102E-13	181	0.466	0.414	F4IVN6.pdb.gz	F4IVN6_ARATH Calmodulin 5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
9	AFDB:P69097	0.553	0.584	2.480E-13	149	0.447	0.483	P69097.pdb.gz	CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=2
10	PDB:5a2hA	0.492	0.532	3.430E-13	147	0.466	0.510	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
11	AFDB:P07463	0.515	0.553	4.303E-13	149	0.466	0.503	P07463.pdb.gz	CALM_PARTE Calmodulin OS=Paramecium tetraurelia OX=5888 GN=CAM PE=1 SV=3
12	AFDB:P60204	0.542	0.580	4.303E-13	149	0.447	0.483	P60204.pdb.gz	CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=camA PE=1 SV=2
13	AFDB:P24044	0.525	0.562	5.989E-13	149	0.460	0.497	P24044.pdb.gz	CALM_PLAFA Calmodulin OS=Plasmodium falciparum OX=5833 GN=CAM PE=1 SV=4
14	PDB:2f2pA	0.512	0.490	1.153E-12	169	0.453	0.432	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
15	PDB:1ggzA	0.465	0.513	1.218E-12	144	0.429	0.479	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
16	PDB:1osaA	0.499	0.536	7.108E-12	148	0.453	0.493	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
17	PDB:3qrxA	0.484	0.532	2.668E-11	145	0.410	0.455	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
18	PDB:6hr1A	0.431	0.179	3.515E-11	406	0.466	0.185	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
19	PDB:6xyrA	0.432	0.209	7.604E-11	348	0.472	0.218	6xyrA.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
20	PDB:6ya9A	0.439	0.191	1.249E-10	400	0.466	0.188	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P63316	3.23e-112	317	161	1.000	1.000	TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens OX=9606 GN=TNNC1 PE=1 SV=1
2	P19123	9.67e-112	316	161	0.994	0.994	TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus OX=10090 GN=Tnnc1 PE=1 SV=1
3	Q4PP99	9.67e-112	316	161	0.994	0.994	Q4PP99_RAT Cardiac troponin C OS=Rattus norvegicus OX=10116 GN=Tnnc1 PE=2 SV=1
4	P63315	1.08e-111	315	161	0.994	0.994	TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus OX=9913 GN=TNNC1 PE=1 SV=1
5	A0A8J8XJV6	1.87e-105	300	156	0.944	0.974	A0A8J8XJV6_RAT Troponin C1, slow skeletal and cardiac type OS=Rattus norvegicus OX=10116 GN=Tnnc1 PE=4 SV=1
6	A0A060XPN3	4.30e-104	296	161	0.932	0.932	A0A060XPN3_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00007298001 PE=4 SV=1
7	Q7ZZB9	2.38e-103	295	161	0.919	0.919	Q7ZZB9_ONCMY Troponin C OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00056460001 PE=1 SV=1
8	Q800V7	1.47e-102	292	161	0.901	0.901	Q800V7_DANRE Cardiac troponin C OS=Danio rerio OX=7955 GN=cTnC PE=1 SV=1
9	Q5XJB2	7.30e-102	291	161	0.894	0.894	Q5XJB2_DANRE Tnnc1 protein OS=Danio rerio OX=7955 GN=tnnc1 PE=2 SV=1
10	A0A8I6A4Q5	4.02e-98	281	155	0.882	0.916	A0A8I6A4Q5_RAT Troponin C1, slow skeletal and cardiac type OS=Rattus norvegicus OX=10116 GN=Tnnc1 PE=4 SV=1
11	Q6IQ64	3.17e-91	264	161	0.882	0.882	Q6IQ64_DANRE Slow-specific troponin C OS=Danio rerio OX=7955 GN=stnnc PE=1 SV=1
12	P02586	7.21e-65	197	160	0.646	0.650	TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNC2 PE=1 SV=2
13	P02585	1.41e-64	196	160	0.646	0.650	TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens OX=9606 GN=TNNC2 PE=1 SV=2
14	A0A060WZV7	5.45e-64	196	197	0.640	0.523	A0A060WZV7_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006413001 PE=4 SV=1
15	A0A060YT85	1.43e-63	194	161	0.627	0.627	A0A060YT85_ONCMY EF-hand domain-containing protein (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020987001 PE=4 SV=1
16	Q9I8U8	3.29e-48	155	160	0.621	0.625	Q9I8U8_DANRE Fast skeletal muscle troponin C OS=Danio rerio OX=7955 GN=tnnc PE=1 SV=1
17	B4DJ51	5.50e-46	149	149	0.478	0.517	B4DJ51_HUMAN Calmodulin 1 (Phosphorylase kinase, delta), isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-72 PE=1 SV=1
18	P0DP23	5.50e-46	149	149	0.478	0.517	CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1
19	P0DP24	5.50e-46	149	149	0.478	0.517	CALM2_HUMAN Calmodulin-2 OS=Homo sapiens OX=9606 GN=CALM2 PE=1 SV=1
20	P0DP25	5.50e-46	149	149	0.478	0.517	CALM3_HUMAN Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07308 DUF1456	1.9e+02	13.8	Protein of unknown function (DUF1456)
2	PF08044 DUF1707	22	16.5	Domain of unknown function (DUF1707)
3	PF17743 DUF5580	63	13.6	Family of unknown function (DUF5580)
4	PF20404 DUF6694	48	15.8	Family of unknown function (DUF6694)
5	PF00036 EF-hand_1	5.8e-22	86.6	EF hand
6	PF14788 EF-hand_10	1.9e+02	13.4	EF hand
7	PF12763 EF-hand_4	0.011	27.0	Cytoskeletal-regulatory complex EF hand
8	PF13202 EF-hand_5	1.7e-11	54.3	EF hand
9	PF13405 EF-hand_6	8.8e-17	70.4	EF-hand domain
10	PF13499 EF-hand_7	6e-24	95.6	EF-hand domain pair
11	PF13833 EF-hand_8	5.8e-23	91.7	EF-hand domain pair
12	PF14658 EF-hand_9	1.1e-09	49.8	EF-hand domain
13	PF03587 EMG1	96	14.1	EMG1/NEP1 methyltransferase
14	PF10591 SPARC_Ca_bdg	0.94	21.2	Secreted protein acidic and rich in cysteine Ca binding region
15	PF00804 Syntaxin	6.6e+02	11.4	Syntaxin
16	PF05099 TerB	13	17.5	Tellurite resistance protein TerB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9986.ENSOCUP00000006896

Rank	PPI partner	STRING score	Description
1	9986.ENSOCUP00000018870	0.998	Troponin T type 2 (cardiac)
2	9986.ENSOCUP00000008977	0.984	Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity
3	9986.ENSOCUP00000001509	0.979	Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity
4	9986.ENSOCUP00000020944	0.927	Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments
5	9986.ENSOCUP00000010163	0.858	Belongs to the tropomyosin family.
6	9986.ENSOCUP00000022333	0.773	Tropomyosin beta chain
7	9986.ENSOCUP00000001825	0.767	Myosin binding protein C, cardiac
8	9986.ENSOCUP00000021291	0.762	Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Forms regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle.
9	9986.ENSOCUP00000014315	0.757	Muscle contraction
10	9986.ENSOCUP00000010665	0.755	Myosin, light chain 3, alkali
11	9986.ENSOCUP00000015748	0.746	Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion
12	9986.ENSOCUP00000021853	0.744	Titin-cap
13	9986.ENSOCUP00000024260	0.733	Cardiac alpha-myosin heavy chain (HC)
14	9986.ENSOCUP00000022183	0.718	Oryctolagus cuniculus tropomodulin 4 (muscle) (TMOD4), mRNA
15	9986.ENSOCUP00000014521	0.706	Uncharacterized protein
16	9986.ENSOCUP00000012415	0.700	Uncharacterized protein
17	9986.ENSOCUP00000008509	0.690	Tropomyosin 4
18	9986.ENSOCUP00000012137	0.690	Tropomyosin alpha-1 chain
19	9986.ENSOCUP00000015041	0.680	Nebulin
20	9986.ENSOCUP00000017406	0.679	Myosin binding protein C, slow type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding
GO:0008092	0.975	cytoskeletal protein binding
GO:0042802	0.538	identical protein binding
GO:0048306	0.409	calcium-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003012	0.986	muscle system process
GO:0060048	0.978	cardiac muscle contraction
GO:0050896	0.957	response to stimulus
GO:0050879	0.923	multicellular organismal movement
GO:0003231	0.913	cardiac ventricle development
GO:0065007	0.904	biological regulation
GO:0050789	0.818	regulation of biological process
GO:0009987	0.527	cellular process
GO:0050794	0.517	regulation of cellular process
GO:0051239	0.482	regulation of multicellular organismal process
GO:0050905	0.425	neuromuscular process
GO:0044057	0.414	regulation of system process
GO:0050881	0.413	musculoskeletal movement
GO:0042221	0.310	response to chemical
GO:0009653	0.306	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	1.000	contractile fiber
GO:0005829	0.957	cytosol
GO:0030016	0.938	myofibril
GO:0030017	0.896	sarcomere
GO:0032991	0.895	protein-containing complex
GO:0015629	0.856	actin cytoskeleton
GO:0036379	0.794	myofilament
GO:0005865	0.562	striated muscle thin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]