StarFunc result for job id P67809

User Input

>input (324 residues)
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL
GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG
QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG
YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P67809	1.000	1.000	6.802E-47	324	1.000	1.000	P67809.pdb.gz	YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3
2	AFDB:O46173	0.337	0.307	2.077E-19	359	0.377	0.340	O46173.pdb.gz	O46173_DROME Y-box protein OS=Drosophila melanogaster OX=7227 GN=yps PE=2 SV=1
3	AFDB:O62213	0.320	0.488	2.826E-17	208	0.290	0.452	O62213.pdb.gz	O62213_CAEEL CSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cey-1 PE=1 SV=1
4	PDB:2l15A	0.205	0.885	4.775E-7	70	0.093	0.429	2l15A.pdb.gz
5	PDB:2lxjA	0.182	0.820	5.253E-6	66	0.099	0.485	2lxjA.pdb.gz
6	PDB:3aqqA	0.181	0.540	1.529E-3	99	0.056	0.182	3aqqA.pdb.gz
7	PDB:1zeqX	0.168	0.530	3.468E-3	84	0.031	0.119	1zeqX.pdb.gz
8	PDB:6d6qG	0.182	0.240	4.045E-2	237	0.031	0.042	6d6qG.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
9	PDB:6d6qH	0.167	0.185	4.289E-2	289	0.034	0.038	6d6qH.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
10	PDB:6w6wC	0.136	0.136	5.746E-2	323	0.034	0.034	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
11	PDB:7ajtEH	0.165	0.217	5.746E-2	237	0.040	0.055	7ajtEH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:3kf6B	0.154	0.399	6.848E-2	105	0.037	0.114	3kf6B.pdb.gz
13	PDB:4a2iL	0.163	0.367	9.174E-2	123	0.034	0.089	4a2iL.pdb.gz	Cryo-Electron Microscopy Structure of the 30S Subunit in Complex with the Yjeq Biogenesis Factor.
14	AFDB:Q7KVD1	0.087	0.020	9.369E-2	2263	0.179	0.026	Q7KVD1.pdb.gz	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
15	AFDB:Q21338	0.088	0.030	9.933E-2	1208	0.201	0.054	Q21338.pdb.gz	SPT5H_CAEEL Transcription elongation factor SPT5 OS=Caenorhabditis elegans OX=6239 GN=spt-5 PE=3 SV=3
16	AFDB:Q9Y5K6	0.086	0.059	3.018E-1	639	0.142	0.072	Q9Y5K6.pdb.gz	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
17	AFDB:Q498M5	0.098	0.051	3.597E-1	735	0.167	0.073	Q498M5.pdb.gz	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
18	AFDB:Q8N196	0.084	0.045	3.814E-1	739	0.142	0.062	Q8N196.pdb.gz	SIX5_HUMAN Homeobox protein SIX5 OS=Homo sapiens OX=9606 GN=SIX5 PE=1 SV=3
19	AFDB:Q08AM8	0.086	0.044	4.287E-1	729	0.148	0.066	Q08AM8.pdb.gz	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
20	AFDB:A0A0B4KF25	0.114	0.045	8.649E-1	1131	0.170	0.049	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62960	0.0	625	322	0.985	0.991	YBOX1_MOUSE Y-box-binding protein 1 OS=Mus musculus OX=10090 GN=Ybx1 PE=1 SV=3
2	P62961	0.0	625	322	0.985	0.991	YBOX1_RAT Y-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ybx1 PE=2 SV=3
3	P67809	0.0	639	324	1.000	1.000	YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3
4	H0Y449	3.61e-120	352	374	0.762	0.660	H0Y449_HUMAN Y-box binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=1
5	C9J5V9	2.33e-97	288	216	0.667	1.000	C9J5V9_HUMAN Y-box binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=1
6	B5DE31	2.65e-86	263	310	0.713	0.745	YBOX1_DANRE Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1
7	Q9JKB3	5.77e-82	254	361	0.543	0.488	YBOX3_MOUSE Y-box-binding protein 3 OS=Mus musculus OX=10090 GN=Ybx3 PE=1 SV=2
8	Q62764	1.83e-73	232	361	0.519	0.465	YBOX3_RAT Y-box-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ybx3 PE=1 SV=1
9	Q9N1Q2	1.79e-58	194	372	0.509	0.444	Q9N1Q2_CANLF Y-box protein ZONAB-B OS=Canis lupus familiaris OX=9615 GN=ZONAB PE=1 SV=1
10	P16989	3.71e-58	193	372	0.506	0.441	YBOX3_HUMAN Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4
11	Q9Y2T7	2.84e-55	186	364	0.336	0.299	YBOX2_HUMAN Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2
12	D4A3P0	7.99e-52	176	359	0.250	0.226	D4A3P0_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=1 SV=1
13	P45441	1.97e-51	174	324	0.244	0.244	YBX2B_XENLA Y-box-binding protein 2-B OS=Xenopus laevis OX=8355 GN=ybx2-b PE=1 SV=2
14	A0A8I5ZJP8	2.17e-51	173	282	0.247	0.284	A0A8I5ZJP8_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=4 SV=1
15	P21574	4.24e-51	174	336	0.247	0.238	YBX2A_XENLA Y-box-binding protein 2-A OS=Xenopus laevis OX=8355 GN=ybx2-a PE=1 SV=3
16	Q9Z2C8	5.22e-51	174	360	0.247	0.222	YBOX2_MOUSE Y-box-binding protein 2 OS=Mus musculus OX=10090 GN=Ybx2 PE=1 SV=1
17	O62213	1.95e-44	152	208	0.222	0.346	O62213_CAEEL CSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cey-1 PE=1 SV=1
18	Q95RE4	1.45e-43	154	352	0.231	0.213	Q95RE4_DROME LD37574p OS=Drosophila melanogaster OX=7227 GN=yps PE=1 SV=1
19	M9NFR5	2.33e-43	154	340	0.231	0.221	M9NFR5_DROME Ypsilon schachtel, isoform B OS=Drosophila melanogaster OX=7227 GN=yps PE=1 SV=1
20	O46173	1.14e-41	150	359	0.231	0.209	O46173_DROME Y-box protein OS=Drosophila melanogaster OX=7227 GN=yps PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00313 CSD	9.3e-23	91.2	'Cold-shock' DNA-binding domain
2	PF08206 OB_RNB	45	15.1	Ribonuclease B OB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014964

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015654	0.981	Synaptotagmin binding, cytoplasmic RNA interacting protein
2	61853.ENSNLEP00000004958	0.960	Heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
3	61853.ENSNLEP00000014270	0.957	LSM14A, mRNA processing body assembly factor
4	61853.ENSNLEP00000003888	0.949	Polyadenylate-binding protein
5	61853.ENSNLEP00000008992	0.943	DEAD (Asp-Glu-Ala-Asp) box helicase 6
6	61853.ENSNLEP00000021884	0.940	DEAH (Asp-Glu-Ala-His) box helicase 9
7	61853.ENSNLEP00000003444	0.935	Insulin-like growth factor 2 mRNA binding protein 1
8	61853.ENSNLEP00000019568	0.931	Splicing factor 3b, subunit 3, 130kDa
9	61853.ENSNLEP00000011245	0.928	Small nuclear ribonucleoprotein polypeptides B and B1
10	61853.ENSNLEP00000008303	0.921	Small nuclear ribonucleoprotein D1 polypeptide 16kDa
11	61853.ENSNLEP00000007065	0.919	Small nuclear ribonucleoprotein polypeptide F
12	61853.ENSNLEP00000002730	0.918	Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
13	61853.ENSNLEP00000008482	0.918	Staufen double-stranded RNA binding protein 1
14	61853.ENSNLEP00000005955	0.917	Cold shock domain containing E1, RNA-binding
15	61853.ENSNLEP00000011861	0.914	Cellular tumor antigen p53
16	61853.ENSNLEP00000010310	0.912	Heterogeneous nuclear ribonucleoprotein R
17	61853.ENSNLEP00000018157	0.912	Heterogeneous nuclear ribonucleoprotein A2/B1
18	61853.ENSNLEP00000018783	0.911	PHD finger protein 5A
19	61853.ENSNLEP00000018945	0.908	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
20	61853.ENSNLEP00000008368	0.907	Splicing factor 3b, subunit 1, 155kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	1.000	DNA binding
GO:0043565	0.967	sequence-specific DNA binding
GO:0019899	0.854	enzyme binding
GO:0003690	0.852	double-stranded DNA binding
GO:1990837	0.825	sequence-specific double-stranded DNA binding
GO:0061980	0.794	regulatory RNA binding
GO:0035198	0.784	miRNA binding
GO:0051020	0.751	GTPase binding
GO:0062153	0.595	C5-methylcytidine-containing RNA binding
GO:0003729	0.531	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0009987	0.988	cellular process
GO:0080090	0.983	regulation of primary metabolic process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0009889	0.958	regulation of biosynthetic process
GO:0048519	0.956	negative regulation of biological process
GO:0010604	0.947	positive regulation of macromolecule metabolic process
GO:0051252	0.947	regulation of RNA metabolic process
GO:0048523	0.940	negative regulation of cellular process
GO:0031326	0.937	regulation of cellular biosynthetic process
GO:0048522	0.935	positive regulation of cellular process
GO:0010605	0.930	negative regulation of macromolecule metabolic process
GO:0010556	0.929	regulation of macromolecule biosynthetic process
GO:0051172	0.920	negative regulation of nitrogen compound metabolic process
GO:0031324	0.918	negative regulation of cellular metabolic process
GO:0031327	0.911	negative regulation of cellular biosynthetic process
GO:0010558	0.903	negative regulation of macromolecule biosynthetic process
GO:0031325	0.895	positive regulation of cellular metabolic process
GO:0051253	0.892	negative regulation of RNA metabolic process
GO:0051173	0.888	positive regulation of nitrogen compound metabolic process
GO:0006355	0.860	regulation of DNA-templated transcription
GO:1903507	0.858	negative regulation of nucleic acid-templated transcription
GO:0045892	0.836	negative regulation of DNA-templated transcription
GO:0010557	0.835	positive regulation of macromolecule biosynthetic process
GO:0031328	0.830	positive regulation of cellular biosynthetic process
GO:0006357	0.765	regulation of transcription by RNA polymerase II
GO:0048583	0.614	regulation of response to stimulus
GO:0050896	0.550	response to stimulus
GO:0045935	0.534	positive regulation of nucleobase-containing compound metabolic process
GO:0051246	0.485	regulation of protein metabolic process
GO:0010646	0.451	regulation of cell communication
GO:0023051	0.446	regulation of signaling
GO:0009966	0.443	regulation of signal transduction
GO:0071704	0.439	organic substance metabolic process
GO:0000122	0.409	negative regulation of transcription by RNA polymerase II
GO:1900076	0.408	regulation of cellular response to insulin stimulus
GO:0051254	0.389	positive regulation of RNA metabolic process
GO:0044238	0.347	primary metabolic process
GO:0006807	0.338	nitrogen compound metabolic process
GO:0044237	0.337	cellular metabolic process
GO:0051716	0.321	cellular response to stimulus
GO:0043170	0.320	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0005634	0.996	nucleus
GO:0032991	0.995	protein-containing complex
GO:1990904	0.981	ribonucleoprotein complex
GO:0140513	0.938	nuclear protein-containing complex
GO:0070013	0.936	intracellular organelle lumen
GO:0031981	0.887	nuclear lumen
GO:0043232	0.861	intracellular non-membrane-bounded organelle
GO:0005829	0.815	cytosol
GO:0005654	0.632	nucleoplasm
GO:0016020	0.598	membrane
GO:0005886	0.494	plasma membrane
GO:0012505	0.456	endomembrane system
GO:0140535	0.380	intracellular protein-containing complex
GO:0010494	0.376	cytoplasmic stress granule
GO:0005689	0.375	U12-type spliceosomal complex
GO:0005783	0.368	endoplasmic reticulum
GO:0070937	0.367	CRD-mediated mRNA stability complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]