StarFunc result for job id P68106

User Input

>input (108 residues)
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97534	1.000	1.000	1.536E-21	108	0.991	0.991	P97534.pdb.gz	FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus OX=10116 GN=Fkbp1b PE=1 SV=3
2	PDB:4c02B	0.989	0.989	6.354E-21	108	1.000	1.000	4c02B.pdb.gz	Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
3	AFDB:Q8AVL7	0.996	0.809	5.463E-20	133	0.907	0.737	Q8AVL7.pdb.gz	Q8AVL7_XENLA peptidylprolyl isomerase (Fragment) OS=Xenopus laevis OX=8355 GN=FKBP1B PE=2 SV=1
4	AFDB:C1BFZ3	0.995	0.995	3.948E-19	108	0.796	0.796	C1BFZ3.pdb.gz	C1BFZ3_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
5	AFDB:A0A060WZU7	0.993	0.993	7.634E-19	108	0.778	0.778	A0A060WZU7.pdb.gz	A0A060WZU7_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006391001 PE=4 SV=1
6	AFDB:O42123	0.994	0.994	1.062E-18	108	0.806	0.806	O42123.pdb.gz	FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis OX=8355 GN=fkbp1a PE=3 SV=3
7	AFDB:Q0VDC6	0.990	0.739	1.476E-18	145	0.833	0.621	Q0VDC6.pdb.gz	Q0VDC6_HUMAN peptidylprolyl isomerase OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=1
8	PDB:1fklA	0.973	0.982	2.535E-18	107	0.843	0.850	1fklA.pdb.gz	Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
9	AFDB:P48375	0.992	0.992	6.874E-18	108	0.704	0.704	P48375.pdb.gz	FKB12_DROME Peptidyl-prolyl cis-trans isomerase Fkbp12 OS=Drosophila melanogaster OX=7227 GN=Fkbp12 PE=3 SV=2
10	PDB:2nd5A	0.966	0.941	1.471E-17	111	0.833	0.811	2nd5A.pdb.gz
11	PDB:7u0sA	0.968	0.846	1.752E-15	124	0.602	0.524	7u0sA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
12	AFDB:Q4WLV6	0.979	0.945	1.972E-15	112	0.602	0.580	Q4WLV6.pdb.gz	FKB1A_ASPFU FK506-binding protein 1A OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=fpr1A PE=1 SV=1
13	AFDB:O94746	0.979	0.979	2.897E-15	108	0.593	0.593	O94746.pdb.gz	FKBP_CRYNH FK506-binding protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=FRR1 PE=1 SV=1
14	AFDB:O42993	0.982	0.948	3.061E-15	112	0.583	0.562	O42993.pdb.gz	FKBP_SCHPO Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fkh1 PE=3 SV=1
15	PDB:6tz8C	0.959	0.934	9.620E-15	111	0.556	0.541	6tz8C.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
16	PDB:7zw0sk	0.944	0.896	7.346E-14	114	0.546	0.518	7zw0sk.pdb.gz	Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
17	PDB:5hw8B	0.957	0.850	3.615E-13	122	0.481	0.426	5hw8B.pdb.gz	Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
18	PDB:5njxA	0.962	0.256	3.615E-13	413	0.472	0.123	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
19	PDB:2mphA	0.897	0.447	9.767E-12	224	0.417	0.201	2mphA.pdb.gz
20	PDB:1q6uA	0.894	0.465	3.456E-11	213	0.435	0.221	1q6uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P68106	1.65e-77	225	108	1.000	1.000	FKB1B_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens OX=9606 GN=FKBP1B PE=1 SV=2
2	P97534	1.11e-76	223	108	0.991	0.991	FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus OX=10116 GN=Fkbp1b PE=1 SV=3
3	Q8HYX6	2.44e-76	222	108	0.991	0.991	FKB1B_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Oryctolagus cuniculus OX=9986 GN=FKBP1B PE=3 SV=3
4	Q9Z2I2	3.25e-75	219	108	0.972	0.972	FKB1B_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus musculus OX=10090 GN=Fkbp1b PE=1 SV=3
5	Q8AVL7	5.74e-73	214	133	0.907	0.737	Q8AVL7_XENLA peptidylprolyl isomerase (Fragment) OS=Xenopus laevis OX=8355 GN=FKBP1B PE=2 SV=1
6	Q8QGU2	2.14e-72	212	108	0.917	0.917	Q8QGU2_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP12.6 PE=2 SV=1
7	Q5XG46	2.41e-72	212	108	0.907	0.907	Q5XG46_XENLA peptidylprolyl isomerase OS=Xenopus laevis OX=8355 GN=fkbp1b.S PE=2 SV=1
8	G1T0U7	2.76e-68	201	96	0.889	1.000	G1T0U7_RABIT peptidylprolyl isomerase OS=Oryctolagus cuniculus OX=9986 GN=FKBP1B PE=4 SV=2
9	P18203	5.43e-68	201	108	0.852	0.852	FKB1A_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Bos taurus OX=9913 GN=FKBP1A PE=1 SV=2
10	P62942	3.88e-67	199	108	0.833	0.833	FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2
11	P62943	3.88e-67	199	108	0.833	0.833	FKB1A_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryctolagus cuniculus OX=9986 GN=FKBP1A PE=1 SV=2
12	Q0VDC6	2.48e-66	198	145	0.833	0.621	Q0VDC6_HUMAN peptidylprolyl isomerase OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=1
13	B5G2R5	3.72e-66	196	108	0.815	0.815	B5G2R5_TAEGU peptidylprolyl isomerase OS=Taeniopygia guttata OX=59729 PE=2 SV=1
14	Q90ZG0	3.72e-66	196	108	0.815	0.815	Q90ZG0_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP12 PE=2 SV=1
15	P26883	2.06e-65	194	108	0.815	0.815	FKB1A_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus OX=10090 GN=Fkbp1a PE=1 SV=2
16	Q62658	2.06e-65	194	108	0.815	0.815	FKB1A_RAT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Rattus norvegicus OX=10116 GN=Fkbp1a PE=1 SV=3
17	A0A060WZU7	1.74e-63	189	108	0.778	0.778	A0A060WZU7_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006391001 PE=4 SV=1
18	O42123	4.51e-63	188	108	0.806	0.806	FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis OX=8355 GN=fkbp1a PE=3 SV=3
19	C1BFZ3	5.09e-63	188	108	0.796	0.796	C1BFZ3_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
20	C1BH42	6.86e-62	186	108	0.787	0.787	C1BH42_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00254 FKBP_C	8.3e-29	111.1	FKBP-type peptidyl-prolyl cis-trans isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000005884

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000014764	0.994	Ryanodine receptor 2 (cardiac)
2	9612.ENSCAFP00000024527	0.932	Serine/threonine-protein kinase mTOR
3	9612.ENSCAFP00000013675	0.915	Serine/threonine-protein kinase receptor
4	9612.ENSCAFP00000003684	0.908	Receptor protein serine/threonine kinase
5	9612.ENSCAFP00000008828	0.879	Ryanodine receptor 1 (skeletal)
6	9612.ENSCAFP00000004829	0.840	Uncharacterized protein
7	9612.ENSCAFP00000039652	0.786	Peptidyl-prolyl cis-trans isomerase
8	9612.ENSCAFP00000010923	0.765	Receptor protein serine/threonine kinase
9	9612.ENSCAFP00000012007	0.764	Ryanodine receptor 3
10	9612.ENSCAFP00000014590	0.763	Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Involved in the positive regulation of epithelial cell migration. Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation (By similarity).
11	9612.ENSCAFP00000021476	0.761	Peptidylprolyl isomerase
12	9612.ENSCAFP00000015262	0.740	Transgelin 3
13	9612.ENSCAFP00000028133	0.698	Mothers against decapentaplegic homolog
14	9612.ENSCAFP00000013825	0.684	Protein phosphatase 3, catalytic subunit, gamma isozyme
15	9612.ENSCAFP00000015652	0.684	Protein phosphatase 3, catalytic subunit, alpha isozyme
16	9612.ENSCAFP00000021839	0.684	Protein phosphatase 3, catalytic subunit, beta isozyme
17	9612.ENSCAFP00000026537	0.679	Peptidyl-prolyl cis-trans isomerase
18	9612.ENSCAFP00000014864	0.661	Serine/threonine-protein kinase receptor
19	9612.ENSCAFP00000014518	0.660	Alpha-synuclein
20	9612.ENSCAFP00000009842	0.654	Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.925	organic cyclic compound binding
GO:1901363	0.921	heterocyclic compound binding
GO:0033218	0.893	amide binding
GO:0005527	0.892	macrolide binding
GO:0003824	0.870	catalytic activity
GO:0140096	0.857	catalytic activity, acting on a protein
GO:0003755	0.839	peptidyl-prolyl cis-trans isomerase activity
GO:0005528	0.700	FK506 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051279	0.997	regulation of release of sequestered calcium ion into cytosol
GO:0032409	0.996	regulation of transporter activity
GO:2001257	0.990	regulation of cation channel activity
GO:1901019	0.985	regulation of calcium ion transmembrane transporter activity
GO:0010880	0.942	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0009987	0.569	cellular process
GO:0048519	0.365	negative regulation of biological process
GO:0048523	0.359	negative regulation of cellular process
GO:0048518	0.352	positive regulation of biological process
GO:0048522	0.338	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016529	0.996	sarcoplasmic reticulum
GO:0031984	0.892	organelle subcompartment
GO:0098827	0.787	endoplasmic reticulum subcompartment
GO:0016020	0.643	membrane
GO:0032991	0.608	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16237	0.839	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	0.839	peptidylprolyl isomerase.

[back to server]