StarFunc result for job id P68400

User Input

>input (391 residues)
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19139	0.875	0.875	3.458E-64	391	0.985	0.985	P19139.pdb.gz	CSK21_RAT Casein kinase II subunit alpha OS=Rattus norvegicus OX=10116 GN=Csnk2a1 PE=1 SV=2
2	PDB:5oniA	0.848	0.993	7.869E-58	334	0.854	1.000	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.
3	AFDB:A0A2R8YF43	0.810	0.872	2.446E-56	363	0.928	1.000	A0A2R8YF43.pdb.gz	A0A2R8YF43_HUMAN Casein kinase 2 alpha 1 OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1
4	AFDB:P18334	0.859	0.933	4.296E-56	360	0.711	0.772	P18334.pdb.gz	CSK2A_CAEEL Casein kinase II subunit alpha OS=Caenorhabditis elegans OX=6239 GN=kin-3 PE=1 SV=1
5	AFDB:P08181	0.846	0.984	2.578E-55	336	0.742	0.863	P08181.pdb.gz	CSK2A_DROME Casein kinase II subunit alpha OS=Drosophila melanogaster OX=7227 GN=CkIIalpha PE=1 SV=2
6	AFDB:B4F7A9	0.843	0.941	6.820E-55	350	0.742	0.829	B4F7A9.pdb.gz	B4F7A9_RAT Casein kinase 2, alpha prime polypeptide OS=Rattus norvegicus OX=10116 GN=Csnk2a2 PE=2 SV=1
7	AFDB:Q08467	0.839	0.802	3.179E-52	409	0.624	0.597	Q08467.pdb.gz	CSK21_ARATH Casein kinase II subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=CKA1 PE=1 SV=3
8	AFDB:O64816	0.846	0.766	1.333E-51	432	0.634	0.574	O64816.pdb.gz	CSK2P_ARATH Casein kinase II subunit alpha-4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CKA4 PE=2 SV=1
9	AFDB:Q08466	0.842	0.817	2.874E-51	403	0.627	0.608	Q08466.pdb.gz	CSK22_ARATH Casein kinase II subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=CKA2 PE=1 SV=3
10	AFDB:Q02720	0.825	0.956	1.339E-48	337	0.568	0.659	Q02720.pdb.gz	CSK2A_DICDI Casein kinase II subunit alpha OS=Dictyostelium discoideum OX=44689 GN=casK PE=2 SV=1
11	AFDB:P40231	0.828	0.975	3.366E-48	332	0.547	0.645	P40231.pdb.gz	CSK2A_SCHPO Casein kinase II subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cka1 PE=2 SV=2
12	PDB:3e3bX	0.832	0.972	8.001E-47	334	0.721	0.844	3e3bX.pdb.gz	Structure of human protein kinase CK2alpha2 with a potent indazole-derivative inhibitor
13	PDB:5xvuA	0.806	0.980	8.434E-46	321	0.532	0.648	5xvuA.pdb.gz	The protein kinase CK2 catalytic domain from Plasmodium falciparum: crystal structure, tyrosine kinase activity and inhibition.
14	PDB:4fi1A	0.815	0.858	4.583E-43	371	0.542	0.571	4fi1A.pdb.gz	Crystal structure of scCK2 alpha in complex with ATP
15	PDB:1unlA	0.646	0.853	1.189E-21	292	0.223	0.298	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
16	PDB:4krcA	0.668	0.868	9.221E-21	297	0.220	0.290	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:1j1bB	0.652	0.698	2.844E-20	364	0.228	0.245	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
18	PDB:3mi9A	0.646	0.760	5.535E-20	329	0.228	0.271	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
19	PDB:4yc3A	0.641	0.836	9.235E-20	295	0.225	0.298	4yc3A.pdb.gz
20	PDB:7cgaA	0.644	0.721	1.541E-19	347	0.238	0.268	7cgaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y5A0	0.0	673	354	0.905	1.000	A0A2R8Y5A0_HUMAN Casein kinase 2 alpha 1 OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1
2	A0A2R8YDP2	0.0	720	354	0.905	1.000	A0A2R8YDP2_HUMAN Casein kinase 2 alpha 1 OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1
3	A0A2R8YF43	0.0	739	363	0.928	1.000	A0A2R8YF43_HUMAN Casein kinase 2 alpha 1 OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1
4	A0A2R8YFU2	0.0	769	374	0.957	1.000	A0A2R8YFU2_HUMAN Casein kinase 2 alpha 1 OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1
5	B4F7A9	0.0	564	350	0.742	0.829	B4F7A9_RAT Casein kinase 2, alpha prime polypeptide OS=Rattus norvegicus OX=10116 GN=Csnk2a2 PE=2 SV=1
6	F7FH41	0.0	517	462	0.683	0.578	F7FH41_RAT Casein kinase 2 alpha 2 OS=Rattus norvegicus OX=10116 GN=Csnk2a2 PE=1 SV=1
7	O54833	0.0	563	350	0.739	0.826	CSK22_MOUSE Casein kinase II subunit alpha' OS=Mus musculus OX=10090 GN=Csnk2a2 PE=1 SV=1
8	P08181	0.0	573	336	0.742	0.863	CSK2A_DROME Casein kinase II subunit alpha OS=Drosophila melanogaster OX=7227 GN=CkIIalpha PE=1 SV=2
9	P18334	0.0	546	360	0.706	0.767	CSK2A_CAEEL Casein kinase II subunit alpha OS=Caenorhabditis elegans OX=6239 GN=kin-3 PE=1 SV=1
10	P19139	0.0	804	391	0.985	0.985	CSK21_RAT Casein kinase II subunit alpha OS=Rattus norvegicus OX=10116 GN=Csnk2a1 PE=1 SV=2
11	P19784	0.0	563	350	0.739	0.826	CSK22_HUMAN Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1
12	P68400	0.0	816	391	1.000	1.000	CSK21_HUMAN Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1
13	Q60737	0.0	806	391	0.987	0.987	CSK21_MOUSE Casein kinase II subunit alpha OS=Mus musculus OX=10090 GN=Csnk2a1 PE=1 SV=2
14	Q61177	0.0	803	391	0.985	0.985	Q61177_MOUSE Casein kinase II alpha subunit OS=Mus musculus OX=10090 GN=Csnk2a1 PE=1 SV=1
15	Q8NEV1	0.0	803	391	0.985	0.985	CSK23_HUMAN Casein kinase II subunit alpha 3 OS=Homo sapiens OX=9606 GN=CSNK2A3 PE=1 SV=2
16	Q9AR27	5.44e-178	500	333	0.642	0.754	HD6_ORYSI Casein kinase II subunit alpha-2 OS=Oryza sativa subsp. indica OX=39946 GN=HD6 PE=2 SV=1
17	O64816	5.24e-175	496	432	0.624	0.565	CSK2P_ARATH Casein kinase II subunit alpha-4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CKA4 PE=2 SV=1
18	Q08467	1.36e-173	492	409	0.624	0.597	CSK21_ARATH Casein kinase II subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=CKA1 PE=1 SV=3
19	Q08466	8.52e-173	489	403	0.627	0.608	CSK22_ARATH Casein kinase II subunit alpha-2 OS=Arabidopsis thaliana OX=3702 GN=CKA2 PE=1 SV=3
20	O64817	4.00e-171	483	333	0.621	0.730	CSK23_ARATH Casein kinase II subunit alpha-3 OS=Arabidopsis thaliana OX=3702 GN=CKA3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.11	23.1	ABC1 atypical kinase-like domain
2	PF01636 APH	0.00043	31.8	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	18	16.4	Choline/ethanolamine kinase
4	PF19250 DUF5898	47	15.4	Family of unknown function (DUF5898)
5	PF13095 FTA2	2.3e+02	12.8	Kinetochore Sim4 complex subunit FTA2
6	PF06293 Kdo	2.4	19.0	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF00069 Pkinase	5.7e-69	244.0	Protein kinase domain
8	PF17667 Pkinase_fungal	0.91	19.8	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	4.3e-17	73.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008574281.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008573281.1	0.999	Casein kinase II subunit beta
2	482537.XP_008573785.1	0.988	Nuclear inhibitor of protein phosphatase 1
3	482537.XP_008573177.1	0.970	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 1 Protein, and 99% coverage of the annotated genomic feature by RNAseq alignments
4	482537.XP_008589307.1	0.952	Nucleolar protein 6
5	482537.XP_008572113.1	0.950	Segment polarity protein dishevelled homolog DVL-2
6	482537.XP_008585746.1	0.950	Ribosomal RNA-processing protein 7 homolog A
7	482537.XP_008574034.1	0.947	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 mRNAs, 14 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008577145.1	0.947	FACT complex subunit SSRP1 isoform X1
9	482537.XP_008566512.1	0.935	U3 small nucleolar RNA-associated protein 18 homolog
10	482537.XP_008572282.1	0.932	FACT complex subunit SPT16
11	482537.XP_008572060.1	0.926	Cellular tumor antigen p53
12	482537.XP_008583518.1	0.925	Catenin beta-1 isoform X1
13	482537.XP_008565033.1	0.915	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008576439.1	0.911	Histone deacetylase 1
15	482537.XP_008587793.1	0.903	Histone deacetylase 2
16	482537.XP_008572109.1	0.893	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
17	482537.XP_008584877.1	0.893	U3 small nucleolar ribonucleoprotein protein IMP3
18	482537.XP_008566264.1	0.889	Kinesin-1 heavy chain
19	482537.XP_008581728.1	0.889	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
20	482537.XP_008577176.1	0.884	Major prion protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:1901363	0.415	heterocyclic compound binding
GO:0097159	0.415	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.985	regulation of biological process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0044238	0.980	primary metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0044237	0.980	cellular metabolic process
GO:0019222	0.980	regulation of metabolic process
GO:1901564	0.964	organonitrogen compound metabolic process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0080090	0.961	regulation of primary metabolic process
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0019538	0.944	protein metabolic process
GO:0043412	0.934	macromolecule modification
GO:0009894	0.914	regulation of catabolic process
GO:0036211	0.913	protein modification process
GO:0006796	0.908	phosphate-containing compound metabolic process
GO:0016310	0.897	phosphorylation
GO:0006468	0.861	protein phosphorylation
GO:0009893	0.854	positive regulation of metabolic process
GO:0050896	0.849	response to stimulus
GO:0051246	0.817	regulation of protein metabolic process
GO:0031323	0.816	regulation of cellular metabolic process
GO:0048522	0.802	positive regulation of cellular process
GO:0010604	0.787	positive regulation of macromolecule metabolic process
GO:0048519	0.764	negative regulation of biological process
GO:0048583	0.746	regulation of response to stimulus
GO:0032502	0.734	developmental process
GO:0048856	0.722	anatomical structure development
GO:0010605	0.707	negative regulation of macromolecule metabolic process
GO:0051172	0.693	negative regulation of nitrogen compound metabolic process
GO:0018105	0.685	peptidyl-serine phosphorylation
GO:0051173	0.667	positive regulation of nitrogen compound metabolic process
GO:2000058	0.661	regulation of ubiquitin-dependent protein catabolic process
GO:0042176	0.660	regulation of protein catabolic process
GO:0051248	0.656	negative regulation of protein metabolic process
GO:0048523	0.616	negative regulation of cellular process
GO:1903051	0.616	negative regulation of proteolysis involved in protein catabolic process
GO:0051128	0.611	regulation of cellular component organization
GO:0040008	0.594	regulation of growth
GO:0010468	0.547	regulation of gene expression
GO:0032501	0.544	multicellular organismal process
GO:0019219	0.462	regulation of nucleobase-containing compound metabolic process
GO:0031099	0.441	regeneration
GO:0051716	0.434	cellular response to stimulus
GO:0032879	0.394	regulation of localization
GO:0031325	0.359	positive regulation of cellular metabolic process
GO:0031326	0.352	regulation of cellular biosynthetic process
GO:0031324	0.351	negative regulation of cellular metabolic process
GO:0010556	0.339	regulation of macromolecule biosynthetic process
GO:0007275	0.336	multicellular organism development
GO:0051247	0.329	positive regulation of protein metabolic process
GO:0051252	0.325	regulation of RNA metabolic process
GO:0048513	0.324	animal organ development
GO:1905475	0.319	regulation of protein localization to membrane
GO:1904375	0.318	regulation of protein localization to cell periphery
GO:1901654	0.317	response to ketone
GO:0033574	0.300	response to testosterone
GO:1903076	0.300	regulation of protein localization to plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0005829	0.985	cytosol
GO:0043228	0.976	non-membrane-bounded organelle
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0016020	0.964	membrane
GO:0140513	0.799	nuclear protein-containing complex
GO:1902494	0.793	catalytic complex
GO:0005694	0.770	chromosome
GO:0071944	0.560	cell periphery
GO:0005886	0.509	plasma membrane
GO:0000785	0.425	chromatin
GO:0140535	0.393	intracellular protein-containing complex
GO:1990234	0.383	transferase complex
GO:0012505	0.381	endomembrane system
GO:0005956	0.301	protein kinase CK2 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]