StarFunc result for job id P68431

User Input

>input (136 residues)
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MRL0	0.850	0.713	6.986E-20	164	0.963	0.799	A8MRL0.pdb.gz	A8MRL0_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=H33 PE=3 SV=1
2	AFDB:P07041	0.979	0.979	2.020E-19	136	0.897	0.897	P07041.pdb.gz	H3_NEUCR Histone H3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=hh3 PE=1 SV=3
3	AFDB:Q55BN9	0.961	0.961	4.880E-18	136	0.831	0.831	Q55BN9.pdb.gz	H33B_DICDI Histone H3.3 type b OS=Dictyostelium discoideum OX=44689 GN=H3b PE=1 SV=1
4	AFDB:O15819	0.943	0.923	1.012E-17	139	0.831	0.813	O15819.pdb.gz	H33A_DICDI Histone H3.3 type a OS=Dictyostelium discoideum OX=44689 GN=H3a PE=1 SV=1
5	PDB:1kx5A	0.800	0.806	1.548E-16	135	0.978	0.985	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
6	AFDB:P0DPK5	0.725	0.672	1.053E-15	147	0.787	0.728	P0DPK5.pdb.gz	H3Y2_HUMAN Histone H3.X OS=Homo sapiens OX=9606 GN=H3Y2 PE=5 SV=1
7	AFDB:Q4GYX7	0.794	0.811	6.568E-13	133	0.551	0.564	Q4GYX7.pdb.gz	Q4GYX7_TRYB2 Histone H3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.2430 PE=1 SV=1
8	PDB:4jjnA	0.715	0.989	1.124E-12	98	0.625	0.867	4jjnA.pdb.gz	Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
9	PDB:5ay8A	0.706	0.988	2.043E-12	97	0.566	0.794	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
10	AFDB:Q9Y812	0.665	0.752	2.646E-12	120	0.559	0.633	Q9Y812.pdb.gz	CENPA_SCHPO Histone H3-like centromeric protein cnp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnp1 PE=1 SV=1
11	AFDB:Q6T367	0.715	0.595	7.649E-12	164	0.610	0.506	Q6T367.pdb.gz	CENH3_ORYSJ Histone H3-like centromeric protein CENH3 OS=Oryza sativa subsp. japonica OX=39947 GN=CENH3 PE=2 SV=1
12	AFDB:Q387X7	0.725	0.710	1.139E-11	139	0.456	0.446	Q387X7.pdb.gz	Q387X7_TRYB2 Histone H3 variant OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1090 PE=3 SV=1
13	AFDB:Q59LN9	0.706	0.461	1.587E-11	211	0.574	0.370	Q59LN9.pdb.gz	CENPA_CANAL Histone H3-like centromeric protein CSE4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CSE4 PE=3 SV=1
14	PDB:7xayD	0.537	0.743	2.167E-9	97	0.610	0.856	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.
15	PDB:7on1e	0.660	0.913	2.474E-9	97	0.463	0.649	7on1e.pdb.gz	Cenp-A nucleosome in complex with Cenp-C
16	PDB:4h9sA	0.495	0.732	3.019E-9	89	0.574	0.876	4h9sA.pdb.gz
17	PDB:6e0cA	0.644	0.879	5.595E-8	99	0.419	0.576	6e0cA.pdb.gz	Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
18	PDB:6xwtA	0.477	0.842	4.343E-4	74	0.221	0.405	6xwtA.pdb.gz
19	PDB:3vh5A	0.450	0.592	3.879E-3	100	0.147	0.200	3vh5A.pdb.gz
20	PDB:5y27A	0.452	0.612	4.429E-3	98	0.096	0.133	5y27A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P68431	1.83e-96	275	136	1.000	1.000	H31_HUMAN Histone H3.1 OS=Homo sapiens OX=9606 GN=H3C1 PE=1 SV=2
2	P68432	1.83e-96	275	136	1.000	1.000	H31_BOVIN Histone H3.1 OS=Bos taurus OX=9913 PE=1 SV=2
3	P68433	1.83e-96	275	136	1.000	1.000	H31_MOUSE Histone H3.1 OS=Mus musculus OX=10090 GN=H3c1 PE=1 SV=2
4	Q6LED0	1.83e-96	275	136	1.000	1.000	H31_RAT Histone H3.1 OS=Rattus norvegicus OX=10116 PE=1 SV=3
5	P02299	3.63e-95	272	136	0.993	0.993	H3_DROME Histone H3 OS=Drosophila melanogaster OX=7227 GN=His3 PE=1 SV=4
6	P84228	3.63e-95	272	136	0.993	0.993	H32_MOUSE Histone H3.2 OS=Mus musculus OX=10090 GN=H3c2 PE=1 SV=2
7	P84233	3.63e-95	272	136	0.993	0.993	H32_XENLA Histone H3.2 OS=Xenopus laevis OX=8355 PE=1 SV=2
8	Q71DI3	3.63e-95	272	136	0.993	0.993	H32_HUMAN Histone H3.2 OS=Homo sapiens OX=9606 GN=H3C15 PE=1 SV=3
9	P08898	1.30e-94	270	136	0.978	0.978	H3_CAEEL Histone H3 OS=Caenorhabditis elegans OX=6239 GN=his-2 PE=1 SV=4
10	Q16695	2.12e-94	270	136	0.971	0.971	H31T_HUMAN Histone H3.1t OS=Homo sapiens OX=9606 GN=H3-4 PE=1 SV=3
11	P59226	5.41e-93	266	136	0.971	0.971	H31_ARATH Histone H3.1 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2
12	P59169	1.03e-92	265	136	0.963	0.963	H33_ARATH Histone H3.3 OS=Arabidopsis thaliana OX=3702 GN=HTR4 PE=1 SV=2
13	Q0JCT1	1.03e-92	265	136	0.963	0.963	H33_ORYSJ Histone H3.3 OS=Oryza sativa subsp. japonica OX=39947 GN=H3 PE=1 SV=2
14	A8MRL0	1.43e-92	266	164	0.963	0.799	A8MRL0_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=H33 PE=3 SV=1
15	Q5TEC6	1.45e-92	265	136	0.971	0.971	H37_HUMAN Histone H3-7 OS=Homo sapiens OX=9606 GN=H3-7 PE=1 SV=1
16	C0HL66	1.55e-92	265	136	0.963	0.963	H33A_DROME Histone H3.3A OS=Drosophila melanogaster OX=7227 GN=His3.3A PE=1 SV=1
17	C0HL67	1.55e-92	265	136	0.963	0.963	H33B_DROME Histone H3.3B OS=Drosophila melanogaster OX=7227 GN=His3.3B PE=1 SV=1
18	C1BEZ2	1.55e-92	265	136	0.963	0.963	C1BEZ2_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
19	P84243	1.55e-92	265	136	0.963	0.963	H33_HUMAN Histone H3.3 OS=Homo sapiens OX=9606 GN=H3-3A PE=1 SV=2
20	P84244	1.55e-92	265	136	0.963	0.963	H33_MOUSE Histone H3.3 OS=Mus musculus OX=10090 GN=H3-3a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	1	21.0	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF15630 CENP-S	0.24	23.1	CENP-S protein
3	PF15511 CENP-T_C	0.57	21.6	Centromere kinetochore component CENP-T histone fold
4	PF00125 Histone	8.9e-49	176.4	Core histone H2A/H2B/H3/H4
5	PF15715 PAF	1.7	20.8	PCNA-associated factor histone like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 59463.ENSMLUP00000021184

Rank	PPI partner	STRING score	Description
1	59463.ENSMLUP00000002097	0.984	Bromodomain PHD finger transcription factor
2	59463.ENSMLUP00000014925	0.928	Death inducer-obliterator 1
3	59463.ENSMLUP00000000055	0.896	Belongs to the histone H2A family.
4	59463.ENSMLUP00000007243	0.893	SPT16 homolog, facilitates chromatin remodeling subunit
5	59463.ENSMLUP00000009780	0.890	Belongs to the histone H2A family.
6	59463.ENSMLUP00000022052	0.890	Belongs to the histone H2A family.
7	59463.ENSMLUP00000022457	0.890	Belongs to the histone H2A family.
8	59463.ENSMLUP00000022739	0.890	annotation not available
9	59463.ENSMLUP00000009662	0.889	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
10	59463.ENSMLUP00000006551	0.888	FACT complex subunit SSRP1
11	59463.ENSMLUP00000001587	0.883	Lysine (K)-specific demethylase 6A
12	59463.ENSMLUP00000004383	0.882	H2A histone family, member X
13	59463.ENSMLUP00000013317	0.882	Lysine (K)-specific demethylase 6B
14	59463.ENSMLUP00000016108	0.876	M-phase phosphoprotein 8
15	59463.ENSMLUP00000019261	0.876	SET domain containing 1A
16	59463.ENSMLUP00000004017	0.873	Histone-lysine N-methyltransferase, H3 lysine-79 specific
17	59463.ENSMLUP00000015650	0.873	Histone acetyltransferase type B catalytic subunit
18	59463.ENSMLUP00000005646	0.870	Belongs to the histone H2A family.
19	59463.ENSMLUP00000020132	0.870	Belongs to the histone H2A family.
20	59463.ENSMLUP00000020398	0.870	Belongs to the histone H2A family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.551	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071824	0.990	protein-DNA complex subunit organization
GO:0050789	0.989	regulation of biological process
GO:0006338	0.956	chromatin remodeling
GO:0034728	0.940	nucleosome organization
GO:0006334	0.890	nucleosome assembly
GO:0019222	0.861	regulation of metabolic process
GO:0050794	0.859	regulation of cellular process
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0010468	0.833	regulation of gene expression
GO:0008152	0.481	metabolic process
GO:0050896	0.457	response to stimulus
GO:0071704	0.447	organic substance metabolic process
GO:0048518	0.447	positive regulation of biological process
GO:0080090	0.443	regulation of primary metabolic process
GO:0051171	0.441	regulation of nitrogen compound metabolic process
GO:0031323	0.438	regulation of cellular metabolic process
GO:0048519	0.420	negative regulation of biological process
GO:0048522	0.404	positive regulation of cellular process
GO:0019219	0.404	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.364	primary metabolic process
GO:0043170	0.354	macromolecule metabolic process
GO:2001141	0.329	regulation of RNA biosynthetic process
GO:0032502	0.325	developmental process
GO:1903506	0.322	regulation of nucleic acid-templated transcription
GO:0048523	0.317	negative regulation of cellular process
GO:0006355	0.311	regulation of DNA-templated transcription
GO:0048856	0.306	anatomical structure development
GO:0032501	0.305	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	0.999	chromosome
GO:0005654	0.998	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0000785	0.827	chromatin
GO:0005737	0.670	cytoplasm
GO:0140513	0.370	nuclear protein-containing complex
GO:0000786	0.356	nucleosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]