StarFunc result for job id P78318

User Input

>input (339 residues)
MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLD
LFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYH
VAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVE
SGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPV
KPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQ
EEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78318	1.000	1.000	1.283E-44	339	1.000	1.000	P78318.pdb.gz	IGBP1_HUMAN Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1
2	AFDB:O08836	0.719	0.717	1.430E-35	340	0.814	0.812	O08836.pdb.gz	IGBP1_RAT Immunoglobulin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igbp1 PE=2 SV=2
3	AFDB:Q9QZ29	0.680	0.673	8.299E-28	343	0.661	0.653	Q9QZ29.pdb.gz	IGB1B_MOUSE Immunoglobulin-binding protein 1b OS=Mus musculus OX=10090 GN=Igbp1b PE=1 SV=1
4	AFDB:Q9VJZ5	0.558	0.501	1.054E-15	380	0.327	0.292	Q9VJZ5.pdb.gz	Q9VJZ5_DROME LD07294p OS=Drosophila melanogaster OX=7227 GN=Tap42 PE=1 SV=2
5	AFDB:Q9N4E9	0.575	0.595	2.233E-15	327	0.283	0.294	Q9N4E9.pdb.gz	PP4RS_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit ppfr-4 OS=Caenorhabditis elegans OX=6239 GN=ppfr-4 PE=1 SV=1
6	AFDB:Q9Y7T1	0.525	0.549	4.905E-12	323	0.251	0.263	Q9Y7T1.pdb.gz	YCJ5_SCHPO Uncharacterized protein C63.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC63.05 PE=3 SV=1
7	AFDB:D2K8N5	0.459	0.390	2.534E-11	403	0.268	0.226	D2K8N5.pdb.gz	TAP46_NICBE PP2A regulatory subunit TAP46 OS=Nicotiana benthamiana OX=4100 GN=TAP46 PE=1 SV=1
8	AFDB:Q04372	0.505	0.471	2.917E-11	366	0.251	0.232	Q04372.pdb.gz	TAP42_YEAST Type 2A phosphatase-associated protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAP42 PE=1 SV=1
9	AFDB:Q8LDQ4	0.462	0.390	1.655E-10	405	0.254	0.212	Q8LDQ4.pdb.gz	TAP46_ARATH PP2A regulatory subunit TAP46 OS=Arabidopsis thaliana OX=3702 GN=TAP46 PE=1 SV=2
10	AFDB:Q57XV0	0.501	0.434	1.125E-7	397	0.189	0.161	Q57XV0.pdb.gz	Q57XV0_TRYB2 TAP42-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.790 PE=4 SV=1
11	PDB:1ihgA	0.198	0.189	6.133E-1	364	0.071	0.066	1ihgA.pdb.gz
12	PDB:3n71A	0.131	0.106	6.736E-1	468	0.068	0.049	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
13	PDB:7kzpH	0.179	0.122	6.736E-1	544	0.056	0.035	7kzpH.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
14	PDB:7dkhI	0.154	0.070	7.399E-1	914	0.080	0.030	7dkhI.pdb.gz
15	PDB:7obeA	0.191	0.148	8.127E-1	480	0.071	0.050	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
16	PDB:7l08AL	0.106	0.182	8.517E-1	174	0.071	0.138	7l08AL.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
17	PDB:4f7rD	0.123	0.168	8.926E-1	238	0.024	0.034	4f7rD.pdb.gz
18	PDB:1t72A	0.133	0.179	9.355E-1	215	0.068	0.107	1t72A.pdb.gz
19	PDB:3euhB	0.120	0.123	9.355E-1	321	0.059	0.062	3euhB.pdb.gz
20	PDB:5yqgC	0.197	0.267	9.355E-1	237	0.041	0.059	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08836	0.0	540	340	0.779	0.776	IGBP1_RAT Immunoglobulin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igbp1 PE=2 SV=2
2	P78318	0.0	703	339	1.000	1.000	IGBP1_HUMAN Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1
3	Q61249	0.0	538	340	0.802	0.800	IGBP1_MOUSE Immunoglobulin-binding protein 1 OS=Mus musculus OX=10090 GN=Igbp1 PE=1 SV=1
4	Q9QZ29	4.32e-148	422	343	0.655	0.647	IGB1B_MOUSE Immunoglobulin-binding protein 1b OS=Mus musculus OX=10090 GN=Igbp1b PE=1 SV=1
5	Q9VJZ5	8.93e-47	164	380	0.327	0.292	Q9VJZ5_DROME LD07294p OS=Drosophila melanogaster OX=7227 GN=Tap42 PE=1 SV=2
6	Q9N4E9	2.14e-42	151	327	0.304	0.315	PP4RS_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit ppfr-4 OS=Caenorhabditis elegans OX=6239 GN=ppfr-4 PE=1 SV=1
7	Q9Y7T1	1.71e-21	95.5	323	0.251	0.263	YCJ5_SCHPO Uncharacterized protein C63.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC63.05 PE=3 SV=1
8	Q04372	1.63e-17	84.7	366	0.263	0.243	TAP42_YEAST Type 2A phosphatase-associated protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAP42 PE=1 SV=1
9	Q8LDQ4	5.70e-13	71.6	405	0.295	0.247	TAP46_ARATH PP2A regulatory subunit TAP46 OS=Arabidopsis thaliana OX=3702 GN=TAP46 PE=1 SV=2
10	D2K8N5	4.11e-12	68.9	403	0.145	0.122	TAP46_NICBE PP2A regulatory subunit TAP46 OS=Nicotiana benthamiana OX=4100 GN=TAP46 PE=1 SV=1
11	Q55FB8	0.54	34.7	1272	0.086	0.023	PSLA_DICDI Presporeless protein A OS=Dictyostelium discoideum OX=44689 GN=pslA PE=1 SV=1
12	X1WCJ5	0.67	34.3	1226	0.080	0.022	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
13	A0A1B0GWS0	1.6	33.1	1266	0.065	0.017	A0A1B0GWS0_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
14	D3ZZ81	1.6	33.1	1190	0.065	0.018	D3ZZ81_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
15	A0A1B0GWM2	1.7	33.1	1218	0.065	0.018	A0A1B0GWM2_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
16	A0A0G2K3L9	1.8	33.1	1142	0.065	0.019	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
17	Q1AHS5	2.4	31.6	158	0.106	0.228	Q1AHS5_9PAPI Protein E6 OS=human papillomavirus 97 OX=338324 GN=E6 PE=3 SV=1
18	A0A0R4IFJ4	2.6	32.7	1181	0.100	0.029	A0A0R4IFJ4_DANRE Pyruvate carboxylase OS=Danio rerio OX=7955 GN=PYCa PE=1 SV=1
19	O75145	5.0	31.6	1194	0.068	0.019	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
20	A0A8I6AK94	6.1	31.2	1261	0.062	0.017	A0A8I6AK94_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17179 Fer4_22	8.5e+02	12.2	4Fe-4S dicluster domain
2	PF08118 MDM31_MDM32	9.6e+02	9.8	Yeast mitochondrial distribution and morphology (MDM) proteins
3	PF04177 TAP42	1.4e-86	302.4	TAP42-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363661

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221138	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
2	9606.ENSP00000418447	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
3	9606.ENSP00000279387	0.997	Serine/threonine-protein phosphatase 4 catalytic subunit
4	9606.ENSP00000392147	0.997	Protein phosphatase 6 catalytic subunit
5	9606.ENSP00000356807	0.979	TIP41-like protein
6	9606.ENSP00000354558	0.969	Serine/threonine-protein kinase mTOR
7	9606.ENSP00000377036	0.967	Serine/threonine-protein phosphatase 2A activator
8	9606.ENSP00000312678	0.946	E3 ubiquitin-protein ligase Midline-1
9	9606.ENSP00000307272	0.935	Regulatory-associated protein of mTOR
10	9606.ENSP00000456405	0.932	Target of rapamycin complex subunit LST8
11	9606.ENSP00000258091	0.865	T-complex protein 1 subunit eta
12	9606.ENSP00000294728	0.823	Vascular cell adhesion protein 1
13	9606.ENSP00000286234	0.809	DEP domain-containing mTOR-interacting protein
14	9606.ENSP00000375711	0.800	Proline-rich AKT1 substrate 1
15	9606.ENSP00000430774	0.778	Uncharacterized protein
16	9606.ENSP00000349124	0.777	Serine/threonine-protein phosphatase 4 regulatory subunit 2
17	9606.ENSP00000379866	0.745	Collagen alpha-4(IV) chain
18	9606.ENSP00000331902	0.744	Collagen alpha-5(IV) chain
19	9606.ENSP00000262843	0.731	Probable E3 ubiquitin-protein ligase MID2
20	9606.ENSP00000375086	0.719	C-C motif chemokine 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019208	1.000	phosphatase regulator activity
GO:0019888	0.994	protein phosphatase regulator activity
GO:0019899	0.889	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048519	0.993	negative regulation of biological process
GO:0019222	0.986	regulation of metabolic process
GO:0048523	0.980	negative regulation of cellular process
GO:0010556	0.947	regulation of macromolecule biosynthetic process
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0019219	0.925	regulation of nucleobase-containing compound metabolic process
GO:1902531	0.907	regulation of intracellular signal transduction
GO:0009987	0.881	cellular process
GO:0060548	0.877	negative regulation of cell death
GO:0031324	0.877	negative regulation of cellular metabolic process
GO:0050896	0.817	response to stimulus
GO:0051246	0.807	regulation of protein metabolic process
GO:0043067	0.806	regulation of programmed cell death
GO:0050790	0.795	regulation of catalytic activity
GO:0031326	0.789	regulation of cellular biosynthetic process
GO:0010605	0.769	negative regulation of macromolecule metabolic process
GO:0051172	0.767	negative regulation of nitrogen compound metabolic process
GO:0043069	0.758	negative regulation of programmed cell death
GO:0009968	0.677	negative regulation of signal transduction
GO:0044092	0.664	negative regulation of molecular function
GO:0051248	0.631	negative regulation of protein metabolic process
GO:0010468	0.579	regulation of gene expression
GO:0042981	0.480	regulation of apoptotic process
GO:0048518	0.478	positive regulation of biological process
GO:0048522	0.451	positive regulation of cellular process
GO:0051252	0.443	regulation of RNA metabolic process
GO:2001141	0.429	regulation of RNA biosynthetic process
GO:1903506	0.416	regulation of nucleic acid-templated transcription
GO:0043066	0.410	negative regulation of apoptotic process
GO:0051716	0.352	cellular response to stimulus
GO:0006355	0.327	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0099080	0.933	supramolecular complex
GO:0005829	0.907	cytosol
GO:0005856	0.848	cytoskeleton
GO:0099081	0.831	supramolecular polymer
GO:0032991	0.808	protein-containing complex
GO:0099512	0.746	supramolecular fiber
GO:0043227	0.720	membrane-bounded organelle
GO:0015630	0.714	microtubule cytoskeleton
GO:0099513	0.700	polymeric cytoskeletal fiber
GO:0043231	0.680	intracellular membrane-bounded organelle
GO:0005874	0.511	microtubule
GO:0070013	0.452	intracellular organelle lumen
GO:0005634	0.428	nucleus
GO:0031981	0.307	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]