StarFunc result for job id P78324

User Input

>input (504 residues)
MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSL
IPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI
TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPL
RGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS
TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNT
AAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI
TQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNR
TPKQPAPKPEPSFSEYASVQVPRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78324	1.000	1.000	1.566E-87	504	1.000	1.000	P78324.pdb.gz	SHPS1_HUMAN Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Homo sapiens OX=9606 GN=SIRPA PE=1 SV=2
2	AFDB:P97797	0.632	0.622	4.239E-64	513	0.671	0.659	P97797.pdb.gz	SHPS1_MOUSE Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Mus musculus OX=10090 GN=Sirpa PE=1 SV=2
3	AFDB:P97710	0.618	0.613	1.314E-62	509	0.671	0.664	P97710.pdb.gz	SHPS1_RAT Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Rattus norvegicus OX=10116 GN=Sirpa PE=1 SV=1
4	AFDB:O00241	0.639	0.800	1.991E-58	398	0.601	0.761	O00241.pdb.gz	SIRB1_HUMAN Signal-regulatory protein beta-1 OS=Homo sapiens OX=9606 GN=SIRPB1 PE=1 SV=5
5	AFDB:Q9P1W8	0.444	0.569	3.302E-53	387	0.550	0.716	Q9P1W8.pdb.gz	SIRPG_HUMAN Signal-regulatory protein gamma OS=Homo sapiens OX=9606 GN=SIRPG PE=1 SV=3
6	AFDB:Q8BLX5	0.577	0.750	1.491E-48	379	0.411	0.546	Q8BLX5.pdb.gz	Q8BLX5_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
7	AFDB:A0A0A6YYP6	0.592	0.740	3.804E-48	397	0.429	0.544	A0A0A6YYP6.pdb.gz	A0A0A6YYP6_MOUSE Signal-regulatory protein beta 1A OS=Mus musculus OX=10090 GN=Sirpb1a PE=4 SV=1
8	AFDB:Q1WIM2	0.339	0.383	4.713E-21	435	0.187	0.216	Q1WIM2.pdb.gz	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
9	AFDB:Q92692	0.315	0.300	1.334E-20	538	0.198	0.186	Q92692.pdb.gz	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
10	AFDB:K4PZ75	0.364	0.361	5.577E-18	510	0.216	0.214	K4PZ75.pdb.gz	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
11	PDB:5c7kF	0.200	0.431	1.375E-14	212	0.103	0.245	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
12	PDB:2rcjC	0.225	0.221	2.436E-14	523	0.125	0.120	2rcjC.pdb.gz
13	PDB:6dcvA	0.230	0.434	1.429E-13	220	0.105	0.241	6dcvA.pdb.gz
14	PDB:1hzhH	0.188	0.205	2.282E-13	457	0.155	0.171	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
15	PDB:1n0xL	0.196	0.416	2.811E-13	215	0.107	0.251	1n0xL.pdb.gz	Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
16	PDB:1i7zA	0.233	0.450	4.489E-13	219	0.117	0.269	1i7zA.pdb.gz	Crystal structure of a cocaine-binding antibody.
17	PDB:2ajsL	0.221	0.435	4.729E-13	216	0.111	0.259	2ajsL.pdb.gz	Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
18	PDB:1cf8L	0.211	0.435	4.981E-13	215	0.103	0.242	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
19	PDB:1igtB	0.199	0.219	4.981E-13	444	0.151	0.171	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
20	PDB:1k4dB	0.223	0.432	4.981E-13	212	0.101	0.241	1k4dB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00241	0.0	621	398	0.583	0.739	SIRB1_HUMAN Signal-regulatory protein beta-1 OS=Homo sapiens OX=9606 GN=SIRPB1 PE=1 SV=5
2	P78324	0.0	1046	504	1.000	1.000	SHPS1_HUMAN Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Homo sapiens OX=9606 GN=SIRPA PE=1 SV=2
3	P97710	0.0	625	509	0.667	0.660	SHPS1_RAT Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Rattus norvegicus OX=10116 GN=Sirpa PE=1 SV=1
4	P97797	0.0	631	513	0.667	0.655	SHPS1_MOUSE Tyrosine-protein phosphatase non-receptor type substrate 1 OS=Mus musculus OX=10090 GN=Sirpa PE=1 SV=2
5	Q9P1W8	0.0	569	387	0.546	0.711	SIRPG_HUMAN Signal-regulatory protein gamma OS=Homo sapiens OX=9606 GN=SIRPG PE=1 SV=3
6	Q8BLX5	4.56e-151	438	379	0.405	0.538	Q8BLX5_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
7	A0A0A6YYP6	2.51e-149	434	397	0.415	0.526	A0A0A6YYP6_MOUSE Signal-regulatory protein beta 1A OS=Mus musculus OX=10090 GN=Sirpb1a PE=4 SV=1
8	Q6F5F0	2.25e-147	429	391	0.419	0.540	Q6F5F0_MOUSE SIRP-beta B-type OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
9	Q6F5F2	3.45e-147	429	391	0.415	0.535	Q6F5F2_MOUSE SIRP-beta B-type OS=Mus musculus OX=10090 GN=Sirpb1a PE=2 SV=1
10	A0A0A6YWR3	1.41e-69	222	182	0.208	0.577	A0A0A6YWR3_MOUSE Signal-regulatory protein beta 1A (Fragment) OS=Mus musculus OX=10090 GN=Sirpb1a PE=4 SV=1
11	Q99N28	1.04e-10	65.9	396	0.143	0.182	CADM3_MOUSE Cell adhesion molecule 3 OS=Mus musculus OX=10090 GN=Cadm3 PE=1 SV=1
12	Q8N126	3.13e-09	61.2	398	0.143	0.181	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
13	Q8BLQ9	2.11e-08	58.9	435	0.127	0.147	CADM2_MOUSE Cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Cadm2 PE=1 SV=2
14	Q1WIM2	2.32e-08	58.5	435	0.127	0.147	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
15	Q8N3J6	3.27e-08	58.2	435	0.103	0.120	CADM2_HUMAN Cell adhesion molecule 2 OS=Homo sapiens OX=9606 GN=CADM2 PE=2 SV=1
16	Q8MRA3	1.88e-07	56.2	1228	0.133	0.055	Q8MRA3_DROME Hibris, isoform A OS=Drosophila melanogaster OX=7227 GN=hbs PE=2 SV=1
17	Q9V787	1.95e-07	56.2	1235	0.133	0.054	Q9V787_DROME Hibris OS=Drosophila melanogaster OX=7227 GN=hbs PE=1 SV=3
18	A1Z9X4	2.00e-07	56.2	1235	0.133	0.054	A1Z9X4_DROME Hibris, isoform B OS=Drosophila melanogaster OX=7227 GN=hbs PE=4 SV=1
19	A0A0B4LEH1	2.46e-06	52.8	1492	0.143	0.048	A0A0B4LEH1_DROME Sticks and stones, isoform C OS=Drosophila melanogaster OX=7227 GN=sns PE=4 SV=1
20	Q0E9F2	2.60e-06	52.8	1542	0.143	0.047	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	9.3e-22	88.5	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	7e-19	79.0	CD80-like C2-set immunoglobulin domain
3	PF20077 CcmD_alt	36	15.8	CcmD family protein
4	PF16915 Eryth_link_C	87	14.6	Annelid erythrocruorin linker subunit C-terminus
5	PF15096 G6B	2.6e+02	12.6	G6B family
6	PF07679 I-set	4.7e-09	47.5	Immunoglobulin I-set domain
7	PF00047 ig	8.9e-14	62.8	Immunoglobulin domain
8	PF13895 Ig_2	4.3e-13	60.7	Immunoglobulin domain
9	PF13927 Ig_3	6.8e-19	79.5	Immunoglobulin domain
10	PF17870 Insulin_TMD	4.5e+02	12.3	Insulin receptor trans-membrane segment
11	PF04478 Mid2	2.2e+02	13.0	Mid2 like cell wall stress sensor
12	PF06024 Orf78	2.8e+02	13.2	Orf78 (ac78)
13	PF14610 Psg1	2.3	19.5	Ykl077w/Psg1 (Pma1 Stabilization in Golgi)
14	PF15330 SIT	0.18	23.7	SHP2-interacting transmembrane adaptor protein, SIT
15	PF15706 TMEM132D_C	1.4e+02	13.6	Mature oligodendrocyte transmembrane protein, TMEM132D, C-term
16	PF15102 TMEM154	2e+02	13.2	TMEM154 protein family
17	PF07686 V-set	3.9e-15	67.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382941

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000355361	0.999	Leukocyte surface antigen CD47
3	9606.ENSP00000362680	0.989	Proto-oncogene tyrosine-protein kinase Src
4	9606.ENSP00000361366	0.987	Pulmonary surfactant-associated protein D
5	9606.ENSP00000401303	0.981	SHC-transforming protein 1
6	9606.ENSP00000391592	0.976	Tyrosine-protein phosphatase non-receptor type 6
7	9606.ENSP00000376345	0.949	Growth factor receptor-bound protein 2
8	9606.ENSP00000262629	0.931	TYRO protein tyrosine kinase-binding protein
9	9606.ENSP00000341189	0.915	Focal adhesion kinase 1
10	9606.ENSP00000380638	0.912	Protein-tyrosine kinase 2-beta
11	9606.ENSP00000305529	0.909	Signal-regulatory protein gamma
12	9606.ENSP00000362205	0.900	Triggering receptor expressed on myeloid cells 2
13	9606.ENSP00000364907	0.867	Tyrosine-protein kinase SYK
14	9606.ENSP00000005587	0.839	Src kinase-associated phosphoprotein 2
15	9606.ENSP00000367830	0.824	Protein kinase C zeta type
16	9606.ENSP00000427114	0.799	FYN-binding protein 1
17	9606.ENSP00000352513	0.764	Myelin protein zero-like protein 1
18	9606.ENSP00000339659	0.749	Tripartite motif-containing protein 2
19	9606.ENSP00000260356	0.743	Thrombospondin-1
20	9606.ENSP00000368190	0.731	Nephrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.979	cell adhesion molecule binding
GO:0098631	0.965	cell adhesion mediator activity
GO:0098632	0.922	cell-cell adhesion mediator activity
GO:0003823	0.702	antigen binding
GO:1990405	0.428	protein antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050896	0.995	response to stimulus
GO:0051716	0.985	cellular response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0051239	0.978	regulation of multicellular organismal process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:1903555	0.957	regulation of tumor necrosis factor superfamily cytokine production
GO:0048519	0.919	negative regulation of biological process
GO:0042221	0.897	response to chemical
GO:0048518	0.863	positive regulation of biological process
GO:0010033	0.856	response to organic substance
GO:0034097	0.853	response to cytokine
GO:0048583	0.837	regulation of response to stimulus
GO:0007155	0.813	cell adhesion
GO:0032680	0.798	regulation of tumor necrosis factor production
GO:0007165	0.798	signal transduction
GO:0031347	0.790	regulation of defense response
GO:0071310	0.696	cellular response to organic substance
GO:0048585	0.685	negative regulation of response to stimulus
GO:0048522	0.617	positive regulation of cellular process
GO:0002376	0.580	immune system process
GO:0071345	0.580	cellular response to cytokine stimulus
GO:0032101	0.543	regulation of response to external stimulus
GO:0002682	0.495	regulation of immune system process
GO:0048523	0.485	negative regulation of cellular process
GO:0009893	0.475	positive regulation of metabolic process
GO:0051171	0.398	regulation of nitrogen compound metabolic process
GO:0050727	0.382	regulation of inflammatory response
GO:0010604	0.382	positive regulation of macromolecule metabolic process
GO:0032502	0.381	developmental process
GO:0051240	0.375	positive regulation of multicellular organismal process
GO:0010646	0.371	regulation of cell communication
GO:0006950	0.370	response to stress
GO:0023051	0.368	regulation of signaling
GO:0031323	0.363	regulation of cellular metabolic process
GO:0009966	0.361	regulation of signal transduction
GO:0002684	0.349	positive regulation of immune system process
GO:0032501	0.346	multicellular organismal process
GO:0048856	0.331	anatomical structure development
GO:0080090	0.328	regulation of primary metabolic process
GO:0007166	0.308	cell surface receptor signaling pathway
GO:0051179	0.300	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0043227	0.998	membrane-bounded organelle
GO:0005622	0.984	intracellular anatomical structure
GO:0031982	0.984	vesicle
GO:0005737	0.971	cytoplasm
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005576	0.928	extracellular region
GO:0031090	0.888	organelle membrane
GO:0005615	0.822	extracellular space
GO:0031410	0.820	cytoplasmic vesicle
GO:0009986	0.817	cell surface
GO:0030659	0.772	cytoplasmic vesicle membrane
GO:0098588	0.734	bounding membrane of organelle
GO:0070062	0.678	extracellular exosome
GO:0030667	0.543	secretory granule membrane
GO:0070820	0.324	tertiary granule
GO:0101002	0.311	ficolin-1-rich granule
GO:0070821	0.306	tertiary granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]