StarFunc result for job id P78325

User Input

>input (824 residues)
MRGLGLWLLGAMMLPAIAPSRPWALMEQYEVVLPWRLPGPRVRRALPSHLGLHPERVSYV
LGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAAS
LSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGP
RTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKL
NFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTT
VGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAG
RCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGE
QCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCD
GRHPECPEDAFQENGTPCSGGYCYNGACPTLAQQCQAFWGPGGQAAEESCFSYDILPGCK
ASRYRADMCGVLQCKGGQQPLGRAICIVDVCHALTTEDGTAYEPVPEGTRCGPEKVCWKG
RCQDLHVYRSSNCSAQCHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHAASGSLPVFVVV
VLVLLAVVLVTLAGIIVYRKARSRILSRNVAPKTTMGRSNPLFHQAASRVPAKGGAPAPS
RGPQELVPTTHPGQPARHPASSVALKRPPPAPPVTVSSPPFPVPVYTRQAPKQVIKPTFA
PPVPPVKPGAGAANPGPAEGAVGPKVALKPPIQRKQGAGAPTAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78325	1.000	1.000	0.000	824	1.000	1.000	P78325.pdb.gz	ADAM8_HUMAN Disintegrin and metalloproteinase domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ADAM8 PE=1 SV=2
2	AFDB:Q05910	0.772	0.770	0.000	826	0.629	0.627	Q05910.pdb.gz	ADAM8_MOUSE Disintegrin and metalloproteinase domain-containing protein 8 OS=Mus musculus OX=10090 GN=Adam8 PE=1 SV=3
3	AFDB:Q7ZYZ9	0.714	0.699	1.081E-80	843	0.377	0.369	Q7ZYZ9.pdb.gz	Q7ZYZ9_DANRE A disintegrin and metalloproteinase domain 8a OS=Danio rerio OX=7955 GN=adam8 PE=2 SV=2
4	AFDB:Q9UKQ2	0.481	0.504	1.009E-71	775	0.339	0.360	Q9UKQ2.pdb.gz	ADA28_HUMAN Disintegrin and metalloproteinase domain-containing protein 28 OS=Homo sapiens OX=9606 GN=ADAM28 PE=1 SV=3
5	AFDB:Q7TSB4	0.605	0.683	1.675E-71	718	0.319	0.366	Q7TSB4.pdb.gz	Q7TSB4_RAT ADAM28 isoform-1 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=2 SV=1
6	AFDB:O35674	0.542	0.493	2.002E-69	920	0.358	0.321	O35674.pdb.gz	ADA19_MOUSE Disintegrin and metalloproteinase domain-containing protein 19 OS=Mus musculus OX=10090 GN=Adam19 PE=2 SV=2
7	AFDB:Q9BZ11	0.622	0.629	3.156E-68	813	0.340	0.344	Q9BZ11.pdb.gz	ADA33_HUMAN Disintegrin and metalloproteinase domain-containing protein 33 OS=Homo sapiens OX=9606 GN=ADAM33 PE=1 SV=2
8	AFDB:Q13443	0.440	0.443	4.265E-64	819	0.324	0.326	Q13443.pdb.gz	ADAM9_HUMAN Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1
9	AFDB:O88839	0.608	0.583	2.319E-62	864	0.319	0.304	O88839.pdb.gz	ADA15_MOUSE Disintegrin and metalloproteinase domain-containing protein 15 OS=Mus musculus OX=10090 GN=Adam15 PE=1 SV=2
10	AFDB:Q10749	0.577	0.759	2.465E-61	609	0.267	0.361	Q10749.pdb.gz	VM3M1_NAJMO Snake venom metalloproteinase-disintegrin-like mocarhagin OS=Naja mossambica OX=8644 PE=1 SV=3
11	PDB:4q1lA	0.234	0.927	1.740E-19	202	0.096	0.391	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:2x7mA	0.164	0.639	5.717E-6	180	0.045	0.206	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
13	PDB:7ufgB	0.186	0.138	7.161E-6	1182	0.095	0.066	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:7ufgA	0.164	0.123	1.129E-4	1151	0.078	0.056	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:8a7eC	0.167	0.099	2.953E-3	1524	0.075	0.041	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:7w72S	0.104	0.147	9.629E-3	533	0.041	0.064	7w72S.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
17	PDB:4krfA	0.104	0.105	6.168E-2	817	0.034	0.034	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
18	PDB:7eu1M	0.046	0.037	1.024E-1	1055	0.016	0.012	7eu1M.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
19	PDB:7rqsA	0.046	0.037	1.146E-1	1074	0.016	0.012	7rqsA.pdb.gz	Structure and RNA template requirements of Arabidopsis RNA-DEPENDENT RNA POLYMERASE 2.
20	PDB:4af8A	0.064	0.114	1.356E-1	333	0.029	0.072	4af8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78325	0.0	1692	824	1.000	1.000	ADAM8_HUMAN Disintegrin and metalloproteinase domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ADAM8 PE=1 SV=2
2	Q05910	0.0	961	826	0.631	0.630	ADAM8_MOUSE Disintegrin and metalloproteinase domain-containing protein 8 OS=Mus musculus OX=10090 GN=Adam8 PE=1 SV=3
3	Q7ZYZ9	0.0	570	843	0.383	0.375	Q7ZYZ9_DANRE A disintegrin and metalloproteinase domain 8a OS=Danio rerio OX=7955 GN=adam8 PE=2 SV=2
4	Q9UKQ2	3.58e-163	494	775	0.354	0.377	ADA28_HUMAN Disintegrin and metalloproteinase domain-containing protein 28 OS=Homo sapiens OX=9606 GN=ADAM28 PE=1 SV=3
5	A0A8I6A4L8	3.72e-157	478	744	0.341	0.378	A0A8I6A4L8_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=1
6	A0A8I5Y766	6.88e-157	478	747	0.341	0.376	A0A8I5Y766_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=1
7	A0A8I5Y6V6	1.12e-156	478	786	0.341	0.358	A0A8I5Y6V6_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=1
8	Q9JLN6	6.70e-156	476	793	0.339	0.352	ADA28_MOUSE Disintegrin and metalloproteinase domain-containing protein 28 OS=Mus musculus OX=10090 GN=Adam28 PE=1 SV=3
9	O43184	1.36e-155	479	909	0.369	0.334	ADA12_HUMAN Disintegrin and metalloproteinase domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ADAM12 PE=1 SV=3
10	Q61824	4.67e-155	478	903	0.359	0.328	ADA12_MOUSE Disintegrin and metalloproteinase domain-containing protein 12 OS=Mus musculus OX=10090 GN=Adam12 PE=1 SV=2
11	E9PTQ3	5.87e-154	471	792	0.362	0.376	E9PTQ3_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=2
12	A0A8I6A4B8	1.47e-153	467	685	0.330	0.397	A0A8I6A4B8_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=1
13	Q7TSB4	1.29e-151	463	718	0.328	0.376	Q7TSB4_RAT ADAM28 isoform-1 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=2 SV=1
14	Q9H013	2.41e-145	454	955	0.326	0.282	ADA19_HUMAN Disintegrin and metalloproteinase domain-containing protein 19 OS=Homo sapiens OX=9606 GN=ADAM19 PE=1 SV=3
15	O35674	1.49e-136	430	920	0.319	0.286	ADA19_MOUSE Disintegrin and metalloproteinase domain-containing protein 19 OS=Mus musculus OX=10090 GN=Adam19 PE=2 SV=2
16	Q9BZ11	4.38e-132	415	813	0.300	0.304	ADA33_HUMAN Disintegrin and metalloproteinase domain-containing protein 33 OS=Homo sapiens OX=9606 GN=ADAM33 PE=1 SV=2
17	A0A384NKT9	1.16e-131	405	540	0.262	0.400	A0A384NKT9_HUMAN ADAM metallopeptidase domain 28, isoform CRA_a OS=Homo sapiens OX=9606 GN=ADAM28 PE=2 SV=1
18	Q10749	6.87e-128	398	609	0.271	0.366	VM3M1_NAJMO Snake venom metalloproteinase-disintegrin-like mocarhagin OS=Naja mossambica OX=8644 PE=1 SV=3
19	A0A8I5Y224	2.73e-126	401	852	0.342	0.331	A0A8I5Y224_RAT ADAM metallopeptidase domain 9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=1 SV=1
20	Q58GH6	3.85e-126	400	845	0.341	0.333	Q58GH6_RAT ADAM9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	18	17.2	ADAMTS cysteine-rich domain 2
2	PF08516 ADAM_CR	6e-05	34.9	ADAM cysteine-rich
3	PF00200 Disintegrin	5.2e-16	70.5	Disintegrin
4	PF07974 EGF_2	3.3	19.5	EGF-like domain
5	PF00413 Peptidase_M10	1.5e+02	13.6	Matrixin
6	PF10462 Peptidase_M66	9e+02	10.2	Peptidase M66
7	PF01562 Pep_M12B_propep	1.9e-28	110.9	Reprolysin family propeptide
8	PF01421 Reprolysin	1.5e-71	252.0	Reprolysin (M12B) family zinc metalloprotease
9	PF13574 Reprolysin_2	8.6e-10	50.4	Metallo-peptidase family M12B Reprolysin-like
10	PF13582 Reprolysin_3	7.4e-13	60.5	Metallo-peptidase family M12B Reprolysin-like
11	PF13583 Reprolysin_4	3.2e-09	48.3	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	5.8e-17	74.0	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000453302

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379350	0.920	Integrin beta-1
2	9606.ENSP00000264741	0.901	Integrin alpha-9
3	9606.ENSP00000306548	0.812	Mitochondrial ribosomal protein L13
4	9606.ENSP00000284142	0.758	Ankyrin repeat and SOCS box protein 17
5	9606.ENSP00000264613	0.720	Ceruloplasmin
6	9606.ENSP00000301585	0.676	Peptidyl-tRNA hydrolase ICT1, mitochondrial
7	9606.ENSP00000369238	0.590	Disintegrin and metalloproteinase domain-containing protein 32
8	9606.ENSP00000380948	0.588	Integrin beta-2
9	9606.ENSP00000451575	0.576	Ankyrin repeat and SOCS box protein 2
10	9606.ENSP00000359935	0.568	Fucose-1-phosphate guanylyltransferase
11	9606.ENSP00000334294	0.549	Transcription factor-like 5 protein
12	9606.ENSP00000358854	0.544	Transcription initiation factor TFIID subunit 5
13	9606.ENSP00000246115	0.536	Sphingosine 1-phosphate receptor 4
14	9606.ENSP00000202625	0.525	Protein-glutamine gamma-glutamyltransferase 6
15	9606.ENSP00000311427	0.520	Sorting nexin-33
16	9606.ENSP00000261868	0.509	Eukaryotic translation initiation factor 3 subunit J
17	9606.ENSP00000265727	0.502	Disintegrin and metalloproteinase domain-containing protein 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding
GO:0008237	1.000	metallopeptidase activity
GO:0008270	0.996	zinc ion binding
GO:0004175	0.953	endopeptidase activity
GO:0043621	0.632	protein self-association
GO:0017171	0.571	serine hydrolase activity
GO:0008236	0.475	serine-type peptidase activity
GO:0004252	0.436	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0048518	0.974	positive regulation of biological process
GO:0050896	0.965	response to stimulus
GO:0048522	0.952	positive regulation of cellular process
GO:0019222	0.936	regulation of metabolic process
GO:0002685	0.922	regulation of leukocyte migration
GO:0002684	0.911	positive regulation of immune system process
GO:0030155	0.893	regulation of cell adhesion
GO:0040017	0.882	positive regulation of locomotion
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0009894	0.867	regulation of catabolic process
GO:2000147	0.862	positive regulation of cell motility
GO:0051247	0.857	positive regulation of protein metabolic process
GO:0006950	0.843	response to stress
GO:0030335	0.840	positive regulation of cell migration
GO:0042221	0.803	response to chemical
GO:0048523	0.782	negative regulation of cellular process
GO:0071840	0.748	cellular component organization or biogenesis
GO:0051716	0.745	cellular response to stimulus
GO:0048583	0.743	regulation of response to stimulus
GO:0016043	0.735	cellular component organization
GO:0045785	0.729	positive regulation of cell adhesion
GO:0031323	0.699	regulation of cellular metabolic process
GO:0022407	0.693	regulation of cell-cell adhesion
GO:0022411	0.678	cellular component disassembly
GO:0022617	0.637	extracellular matrix disassembly
GO:0002687	0.636	positive regulation of leukocyte migration
GO:0042176	0.635	regulation of protein catabolic process
GO:0032879	0.628	regulation of localization
GO:0071704	0.627	organic substance metabolic process
GO:0006952	0.604	defense response
GO:0044238	0.598	primary metabolic process
GO:0045732	0.597	positive regulation of protein catabolic process
GO:0031325	0.592	positive regulation of cellular metabolic process
GO:0045862	0.587	positive regulation of proteolysis
GO:0070887	0.577	cellular response to chemical stimulus
GO:0032502	0.567	developmental process
GO:0002691	0.564	regulation of cellular extravasation
GO:0031329	0.485	regulation of cellular catabolic process
GO:0006807	0.470	nitrogen compound metabolic process
GO:0032501	0.431	multicellular organismal process
GO:0048856	0.427	anatomical structure development
GO:0070482	0.419	response to oxygen levels
GO:0043170	0.415	macromolecule metabolic process
GO:0007165	0.412	signal transduction
GO:1901564	0.389	organonitrogen compound metabolic process
GO:0051239	0.356	regulation of multicellular organismal process
GO:1903829	0.306	positive regulation of protein localization
GO:0019538	0.301	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0043229	0.996	intracellular organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0012505	0.987	endomembrane system
GO:0005737	0.976	cytoplasm
GO:0005576	0.924	extracellular region
GO:0031090	0.901	organelle membrane
GO:0031982	0.886	vesicle
GO:0031410	0.871	cytoplasmic vesicle
GO:0005615	0.819	extracellular space
GO:0098588	0.706	bounding membrane of organelle
GO:0030141	0.686	secretory granule
GO:0043232	0.683	intracellular non-membrane-bounded organelle
GO:0070013	0.646	intracellular organelle lumen
GO:0032991	0.625	protein-containing complex
GO:0009986	0.579	cell surface
GO:0043230	0.426	extracellular organelle
GO:0070062	0.423	extracellular exosome
GO:0005856	0.338	cytoskeleton
GO:0015629	0.303	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.436	Serine endopeptidases.

[back to server]