StarFunc result for job id P78330

User Input

>input (225 residues)
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKA
ALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
SKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDG
ATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78330	1.000	1.000	3.853E-48	225	1.000	1.000	P78330.pdb.gz	SERB_HUMAN Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2
2	PDB:6hyjB	0.948	0.957	2.386E-42	223	0.978	0.987	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
3	AFDB:O82796	0.955	0.731	1.584E-31	295	0.498	0.380	O82796.pdb.gz	SERC_ARATH Phosphoserine phosphatase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSP PE=1 SV=2
4	AFDB:Q9VSY6	0.944	0.789	1.390E-30	270	0.476	0.396	Q9VSY6.pdb.gz	SERB_DROME Phosphoserine phosphatase OS=Drosophila melanogaster OX=7227 GN=aay PE=2 SV=1
5	AFDB:P42941	0.821	0.608	6.128E-15	309	0.271	0.197	P42941.pdb.gz	SERB_YEAST Phosphoserine phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SER2 PE=1 SV=1
6	AFDB:P0AGB0	0.818	0.583	2.176E-14	322	0.271	0.189	P0AGB0.pdb.gz	SERB_ECOLI Phosphoserine phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=serB PE=1 SV=1
7	AFDB:O53289	0.816	0.464	2.155E-13	409	0.240	0.132	O53289.pdb.gz	SERB2_MYCTU Phosphoserine phosphatase SerB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serB2 PE=1 SV=1
8	AFDB:Q6FND4	0.776	0.600	3.492E-13	295	0.267	0.203	Q6FND4.pdb.gz	Q6FND4_CANGA phosphoserine phosphatase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SER2 PE=3 SV=1
9	PDB:5it0A	0.809	0.477	3.713E-13	396	0.231	0.131	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
10	AFDB:A0QJI1	0.816	0.463	1.099E-12	411	0.240	0.131	A0QJI1.pdb.gz	SERB_MYCA1 Phosphoserine phosphatase OS=Mycobacterium avium (strain 104) OX=243243 GN=serB PE=1 SV=1
11	AFDB:Q969T7	0.696	0.548	6.996E-10	300	0.191	0.143	Q969T7.pdb.gz	5NT3B_HUMAN 7-methylguanosine phosphate-specific 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C3B PE=1 SV=4
12	AFDB:P53981	0.756	0.711	2.803E-9	241	0.191	0.178	P53981.pdb.gz	PYP1_YEAST Polyol phosphate phosphatase PYP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PYP1 PE=1 SV=1
13	PDB:7zeeA	0.602	0.501	5.130E-9	282	0.213	0.170	7zeeA.pdb.gz	Substrate-Based Design of Cytosolic Nucleotidase IIIB Inhibitors and Structural Insights into Inhibition Mechanism.
14	PDB:1rkuA	0.717	0.776	2.952E-8	206	0.191	0.209	1rkuA.pdb.gz	The thrH Gene Product of Pseudomonas aeruginosa Is a Dual Activity Enzyme with a Novel Phosphoserine:Homoserine Phosphotransferase Activity.
15	PDB:4uauA	0.643	0.641	1.102E-6	226	0.173	0.173	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
16	PDB:4nv0B	0.659	0.518	1.244E-6	300	0.204	0.153	4nv0B.pdb.gz	Crystal Structures of the Novel Cytosolic 5'-Nucleotidase IIIB Explain Its Preference for m7GMP
17	PDB:1te2A	0.520	0.535	8.577E-6	218	0.191	0.197	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
18	PDB:1ynsA	0.457	0.412	1.996E-5	254	0.164	0.146	1ynsA.pdb.gz	Crystal structure of human e1 enzyme and its complex with a substrate analog reveals the mechanism of its phosphatase/enolase
19	PDB:4g9bA	0.512	0.508	4.118E-5	227	0.169	0.167	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
20	PDB:5olwA	0.480	0.482	7.996E-5	224	0.182	0.183	5olwA.pdb.gz	Observing enzyme ternary transition state analogue complexes by19F NMR spectroscopy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78330	6.89e-168	463	225	1.000	1.000	SERB_HUMAN Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2
2	Q5M819	1.72e-158	439	225	0.947	0.947	SERB_RAT Phosphoserine phosphatase OS=Rattus norvegicus OX=10116 GN=Psph PE=2 SV=1
3	Q99LS3	6.40e-158	437	225	0.938	0.938	SERB_MOUSE Phosphoserine phosphatase OS=Mus musculus OX=10090 GN=Psph PE=1 SV=1
4	O82796	2.67e-73	226	295	0.502	0.383	SERC_ARATH Phosphoserine phosphatase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSP PE=1 SV=2
5	Q9VSY6	2.92e-71	220	270	0.484	0.404	SERB_DROME Phosphoserine phosphatase OS=Drosophila melanogaster OX=7227 GN=aay PE=2 SV=1
6	P0AGB0	2.50e-19	86.7	322	0.258	0.180	SERB_ECOLI Phosphoserine phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=serB PE=1 SV=1
7	P42941	1.37e-16	79.0	309	0.280	0.204	SERB_YEAST Phosphoserine phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SER2 PE=1 SV=1
8	Q6FND4	2.92e-15	75.1	295	0.244	0.186	Q6FND4_CANGA phosphoserine phosphatase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SER2 PE=3 SV=1
9	O53289	4.84e-14	72.4	409	0.271	0.149	SERB2_MYCTU Phosphoserine phosphatase SerB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serB2 PE=1 SV=1
10	O15172	1.82e-13	65.5	72	0.129	0.403	PSPHL_HUMAN Putative phosphoserine phosphatase-like protein OS=Homo sapiens OX=9606 GN=PSPHP1 PE=5 SV=1
11	A0QJI1	1.94e-11	64.7	411	0.271	0.148	SERB_MYCA1 Phosphoserine phosphatase OS=Mycobacterium avium (strain 104) OX=243243 GN=serB PE=1 SV=1
12	A0A0G2K097	0.082	35.8	288	0.133	0.104	A0A0G2K097_RAT 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c3a PE=1 SV=1
13	A0A8I6AHB0	0.088	35.8	331	0.133	0.091	A0A8I6AHB0_RAT 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c3a PE=3 SV=1
14	Q9D020	0.088	35.8	331	0.133	0.091	5NT3A_MOUSE Cytosolic 5'-nucleotidase 3A OS=Mus musculus OX=10090 GN=Nt5c3a PE=1 SV=4
15	Q55DN5	0.14	35.4	1386	0.120	0.019	Q55DN5_DICDI P-type ATPase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269590 PE=4 SV=2
16	X6RM59	0.14	35.4	331	0.084	0.057	X6RM59_HUMAN 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C3A PE=1 SV=1
17	A0A090N7U2	0.15	35.0	285	0.084	0.067	A0A090N7U2_HUMAN 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C3 PE=3 SV=1
18	Q9H0P0	0.15	35.0	336	0.084	0.057	5NT3A_HUMAN Cytosolic 5'-nucleotidase 3A OS=Homo sapiens OX=9606 GN=NT5C3A PE=1 SV=3
19	Q6R3K6	0.17	35.0	676	0.133	0.044	YSL6_ARATH Probable metal-nicotianamine transporter YSL6 OS=Arabidopsis thaliana OX=3702 GN=YSL6 PE=2 SV=2
20	A0A669KA36	0.27	34.7	1110	0.129	0.026	A0A669KA36_HUMAN P-type Cu(+) transporter (Fragment) OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03767 Acid_phosphat_B	73	14.4	HAD superfamily, subfamily IIIB (Acid phosphatase)
2	PF09949 APP1_cat	81	14.5	Phosphatidate phosphatase APP1, catalytic domain
3	PF12710 HAD	1.3e-08	47.1	haloacid dehalogenase-like hydrolase
4	PF13419 HAD_2	0.084	24.5	Haloacid dehalogenase-like hydrolase
5	PF00702 Hydrolase	1.1e-13	63.5	haloacid dehalogenase-like hydrolase
6	PF08282 Hydrolase_3	6e+02	11.6	haloacid dehalogenase-like hydrolase
7	PF06888 Put_Phosphatase	0.37	21.7	Putative Phosphatase
8	PF06406 StbA	52	14.5	StbA protein
9	PF05822 UMPH-1	0.031	25.3	Pyrimidine 5'-nucleotidase (UMPH-1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365773	0.996	Phosphoserine aminotransferase
2	9606.ENSP00000333667	0.986	Serine hydroxymethyltransferase, mitochondrial
3	9606.ENSP00000318868	0.984	Serine hydroxymethyltransferase, cytosolic
4	9606.ENSP00000302620	0.963	Alanine-glyoxylate aminotransferase
5	9606.ENSP00000257549	0.944	L-serine dehydratase/L-threonine deaminase
6	9606.ENSP00000358417	0.944	D-3-phosphoglycerate dehydrogenase
7	9606.ENSP00000381231	0.935	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
8	9606.ENSP00000339435	0.934	Serine racemase
9	9606.ENSP00000385790	0.924	Serine dehydratase-like
10	9606.ENSP00000216484	0.810	Serine palmitoyltransferase 2
11	9606.ENSP00000381968	0.810	Serine palmitoyltransferase 3
12	9606.ENSP00000262554	0.806	Serine palmitoyltransferase 1
13	9606.ENSP00000360268	0.790	Delta-1-pyrroline-5-carboxylate synthase
14	9606.ENSP00000255189	0.734	Dimethylglycine dehydrogenase, mitochondrial
15	9606.ENSP00000371253	0.689	Trifunctional purine biosynthetic protein adenosine-3
16	9606.ENSP00000370737	0.682	Glycine dehydrogenase (decarboxylating), mitochondrial
17	9606.ENSP00000384949	0.671	Pyrroline-5-carboxylate reductase 1, mitochondrial
18	9606.ENSP00000351807	0.643	Elastin
19	9606.ENSP00000377617	0.642	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
20	9606.ENSP00000236959	0.637	Bifunctional purine biosynthesis protein PURH

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0000287	0.999	magnesium ion binding
GO:0036424	0.998	L-phosphoserine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:1901564	0.950	organonitrogen compound metabolic process
GO:0044281	0.903	small molecule metabolic process
GO:0009058	0.886	biosynthetic process
GO:1901576	0.872	organic substance biosynthetic process
GO:0044283	0.857	small molecule biosynthetic process
GO:1901605	0.856	alpha-amino acid metabolic process
GO:0046394	0.828	carboxylic acid biosynthetic process
GO:0009069	0.813	serine family amino acid metabolic process
GO:0008652	0.790	amino acid biosynthetic process
GO:1901607	0.749	alpha-amino acid biosynthetic process
GO:0006563	0.747	L-serine metabolic process
GO:0009070	0.579	serine family amino acid biosynthetic process
GO:0050896	0.333	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.991	cytoplasm
GO:0005829	0.981	cytosol
GO:0043226	0.788	organelle
GO:0043227	0.783	membrane-bounded organelle
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0070013	0.409	intracellular organelle lumen
GO:0120025	0.394	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21208	0.998	H2O + O-phospho-L-serine = L-serine + phosphate
EC:3.1.3.3	0.998	phosphoserine phosphatase.

[back to server]